CRMP4 Antibody - BSA Free

Western Blot: CRMP4 Antibody [NBP2-87213] - WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Transfected 293T

Immunohistochemistry: CRMP4 Antibody [NBP2-87213] - Immunohistochemistry with Small intestine, submucosal plexus tissue. Antibody concentration: 10ug/ml

Immunoprecipitation: CRMP4 Antibody [NBP2-87213] - DRYSL3 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP2-87213 with 1:200 dilution. Western blot was performed using NBP2-87213 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: DRYSL3 IP with NBP2-87213

• Reactivity: Hu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CRMP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CRMP4 Antibody - BSA Free (NBP2-87213) is a polyclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRMP4. Peptide sequence: VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPYSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CRMP4 Antibody - BSA Free

• Collapsin response mediator protein 4
• CRMP-4
• CRMP4collapsin response mediator protein 4 long
• dihydropyrimidinase-like 3
• DRP-3dihydropyrimidinase-related protein 3
• DRP3ULIP1
• ULIP-1
• ULIPLCRMP
• Unc-33-like phosphoprotein 1

Background

The collapsin response mediator protein (CRMP) family of five cytosolic phosphoproteins are highly expressed throughout brain development. The functions of CRMPs encompass signal transduction in developmental guidance cues as well as multiple cellular and molecular events involved in apoptosis/proliferation, cell migration, and differentiation. In the adult brain, the expression of CRMPs is dramatically downregulated. However, CRMPs remain expressed in structures that retain their capacity for differentiation and plasticity. The expression of CRMPs is altered in neurodegenerative diseases, and these proteins may have a role in the physiopathology of the adult nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPYSL3