CREBL2 Antibody

Immunocytochemistry/Immunofluorescence: CREBL2 Antibody [NBP1-86200] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: CREBL2 Antibody [NBP1-86200] - Staining of human adrenal gland shows strong cytoplsmic positivity in glandular cells.

Product Discontinued

CREBL2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREBL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CREBL2 Antibody

• cAMP responsive element binding protein-like 2
• cAMP-responsive element-binding protein-like 2
• MGC117311
• MGC138362

Background

cAMP response element (CRE)-binding protein-like-2 (CREBL2) was identified in a search to find genes in a commonlydeleted region on chromosome 12p13 flanked by ETV6 and CDKN1B genes, frequently associated with hematopoieticmalignancies, as well as breast, non-small-cell lung and ovarian cancers. CREBL2 shares a 41% identity withCRE-binding protein (CREB) over a 48-base long region which encodes the bZip domain of CREB. The bZip domain consistsof about 30 amino acids rich in basic residues involved in DNA binding, followed by a leucine zipper motif involved inprotein dimerization. This suggests that CREBL2 encodes a protein with DNA binding capabilities. The occurance ofCREBL2 deletion in malignancy suggests that CREBL2 may act as a tumor suppressor gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CREBL2