CKMT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining in human heart muscle and lymph node tissues using anti-CKMT2 antibody. Corresponding CKMT2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: CKMT2 Antibody [NBP2-13841] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKMT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKMT2 Antibody - BSA Free (NBP2-13841) is a polyclonal antibody validated for use in IHC and WB. Anti-CKMT2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKMT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CKMT2 Protein (NBP2-13841PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKMT2 Antibody - BSA Free

• Basic-type mitochondrial creatine kinase
• creatine kinase S-type, mitochondrial
• creatine kinase, mitochondrial 2 (sarcomeric)
• EC 2.7.3
• EC 2.7.3.2
• mib-CK
• Sarcomeric mitochondrial creatine kinase
• SMTCK
• S-MtCK

Background

CKMT2 belongs to the creatine kinase isoenzyme family, and is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It exists as two isoenzymes, sarcomeric CKMT2 and ubiquitous CKMT2, which are encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CKMT2 Antibody (NBP2-13841)(2)

Publications using NBP2-13841

• Shaw A, TOth B, Arianti R Et al. BMP7 increases UCP1-dependent and independent thermogenesis with a unique gene expression program in human neck area derived adipocytes Pharmaceuticals 2021-09-28 [PMID: 34832860] (WB)
• Shaw A Thermogenic regulation of human abdominal and neck area derived adipocytes by mitophagy, irisin and BMP7 Thesis 2022-01-01 (WB, Human)
  
  Details:
  Dilution used for WB 1:1000

Bioinformatics

• Gene Symbol: CKMT2