Recombinant Human CRB3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CRB3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 120 of Human CRB3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CRB3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRB3 Protein

  • crumbs 3
  • crumbs homolog 3 (Drosophila)
  • crumbs protein homolog 3
  • MGC17303

Background

This gene encodes a member of the Crumbs family of proteins. This protein may play a role in epithelial cell polarity and is associated with tight junctions at the apical surface of epithelial cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7979
Species: Hu, Mu, Rt
Applications: WB
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-56113
Species: Hu
Applications: IHC-P
NBP1-91809
Species: Hu
Applications: IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46234
Species: Hu
Applications: WB, IHC
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58844
Species: Hu
Applications: ICC/IF
H00092359-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CRB3 Recombinant Protein (H00092359-P01) (0)

There are no publications for CRB3 Recombinant Protein (H00092359-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB3 Recombinant Protein (H00092359-P01) (0)

There are no reviews for CRB3 Recombinant Protein (H00092359-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRB3 Recombinant Protein (H00092359-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRB3 Products

Bioinformatics Tool for CRB3 Recombinant Protein (H00092359-P01)

Discover related pathways, diseases and genes to CRB3 Recombinant Protein (H00092359-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRB3 Recombinant Protein (H00092359-P01)

Discover more about diseases related to CRB3 Recombinant Protein (H00092359-P01).
 

Pathways for CRB3 Recombinant Protein (H00092359-P01)

View related products by pathway.

PTMs for CRB3 Recombinant Protein (H00092359-P01)

Learn more about PTMs related to CRB3 Recombinant Protein (H00092359-P01).

Blogs on CRB3

There are no specific blogs for CRB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987
CRB3 Antibody
NBP1-81185

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRB3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRB3