Home » CPT2 » CPT2 Antibodies » CPT2 Antibody (1G7)

CPT2 Antibody (1G7)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: CPT2 Antibody (1G7) [H00001376-M02] - Detection limit for recombinant GST tagged CPT2 is approximately 0.3ng/ml as a capture antibody.
Sandwich ELISA: CPT2 Antibody (1G7) [H00001376-M02] - Detection limit for recombinant GST tagged CPT2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CPT2 Antibody (1G7) Summary

Immunogen
CPT2 (AAH05172, 351 a.a. - 450 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Specificity
CPT2 - carnitine palmitoyltransferase II
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Positive Control
CPT2 Lysate (NBP2-65409)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPT2 Antibody (1G7)

  • carnitine O-palmitoyltransferase 2, mitochondrial
  • carnitine palmitoyltransferase 2
  • Carnitine palmitoyltransferase IIEC 2.3.1.21
  • CPT II
  • CPT1
  • CPTASE

Background

The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CPT1A Antibody
NB100-53791
Western Blot: CPT1A Antibody [NB100-53791] - (0.1ug/ml) staining of human liver lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CPT1A Antibody [NB100-53791] - (4 ug/ml) staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CPT1A Antibody [NB100-53791] - (4 ug/ml) staining of paraffin embedded Human Kidney Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(5 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - 293T cell lysate. Image from verified customer review.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
CHPT1
Overexpression Lysate
NBP2-06672
Western Blot: CHPT1 Overexpression Lysate (Adult Normal) [NBP2-06672] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for CHPT1.
Species: Hu
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-84975
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-84975] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CRAT Antibody
NBP1-86614
Western Blot: CRAT Antibody [NBP1-86614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Analysis in human testis and tonsil tissues using Anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Fas/TNFRSF6/CD95
Antibody
NB120-13550
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - FAS Western blot for whole cell lysate from mouse testis.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Staining of human hepatoma tissue with Fas polyclonal antibody.
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Analysis of mouse testis tissue extractm probed with Fas polyclonal antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Acetyl-CoA
Carboxylase alpha/ACA ...
AF6898
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, C2C12 mouse myoblast cell line, and rat liver tissue. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat Acetyl-CoA Carboxylase alpha /ACACA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6898) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Acetyl-CoA Carboxylase alpha /ACACA at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [1761].
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AMPK alpha 1
Antibody
NB100-239
Western Blot: AMPK alpha 1 Antibody [NB100-239] - Extracts from 1. bovine aortic endothelial cells, 2. rat aortic smooth muscle cells, 3. HepG2 cells, or 4. human aortic endothelial cells. Antibody used at 2 ug/ml.
Immunohistochemistry-Paraffin: AMPK alpha 1 Antibody [NB100-239] - Human muscle; Antibody used at a dilution of 1:5,000 (0.2ug/ml).
(1 Review)
(12 Publications)
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
CPT1B Antibody
NBP1-59576
Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color
Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200
Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
ACADVL Antibody
NBP1-89287
Western Blot: ACADVL Antibody [NBP1-89287] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: ACADVL Antibody [NBP1-89287] - Immunofluorescent staining of human cell line A549 shows localization to nucleus, nucleoli & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACADVL Antibody [NBP1-89287] - Staining in human duodenum and lymph node tissues using anti-ACADVL antibody. Corresponding ACADVL RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
OCTN2/SLC22A5
Knockout HeLa Cell Ly
NBP2-65203
OCTN2/SLC22A5 Knockout HeLa Cell Lysate
Species: Hu
CD36/SR-B3 Antibody
NB400-144
Western Blot: CD36/SR-B3 Antibody [NB400-144] - Total protein from Human Skin and Adipose tissue, Mouse Adipose and Rat Adipose tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CD36 in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Western Blot: CD36/SR-B3 Antibody [NB400-144] - Detection of CD36 in human adipocyte extract (30 ug). Lane 1: 0.5 ug/ml NB 400-144; lane 2: 2 ug/ml NB 400-144. ECL: 3 second exposure.
Immunocytochemistry/Immunofluorescence: CD36/SR-B3 Antibody [NB400-144] - CD36 antibody was tested in HepG2 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(7 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CPT2 Antibody (H00001376-M02) (0)

There are no publications for CPT2 Antibody (H00001376-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT2 Antibody (H00001376-M02) (0)

There are no reviews for CPT2 Antibody (H00001376-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT2 Antibody (H00001376-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

CPT2 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional CPT2 Products

Bioinformatics Tool for CPT2 Antibody (H00001376-M02)

Discover related pathways, diseases and genes to CPT2 Antibody (H00001376-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT2 Antibody (H00001376-M02)

Discover more about diseases related to CPT2 Antibody (H00001376-M02).
 

Pathways for CPT2 Antibody (H00001376-M02)

View related products by pathway.

PTMs for CPT2 Antibody (H00001376-M02)

Learn more about PTMs related to CPT2 Antibody (H00001376-M02).

Blogs on CPT2

There are no specific blogs for CPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPT2 Antibody (1G7) and receive a gift card or discount.


Bioinformatics

Gene Symbol CPT2
Entrez
OMIM
Uniprot