Home » CPT2 » CPT2 Research Products » CPT2 Antibody (1G7)

CPT2 Antibody (1G7)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: CPT2 Antibody (1G7) [H00001376-M02] - Detection limit for recombinant GST tagged CPT2 is approximately 0.3ng/ml as a capture antibody.
Sandwich ELISA: CPT2 Antibody (1G7) [H00001376-M02] - Detection limit for recombinant GST tagged CPT2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CPT2 Antibody (1G7) Summary

Immunogen
CPT2 (AAH05172, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Specificity
CPT2 - carnitine palmitoyltransferase II
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
CPT2 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPT2 Antibody (1G7)

  • carnitine O-palmitoyltransferase 2, mitochondrial
  • carnitine palmitoyltransferase 2
  • Carnitine palmitoyltransferase IIEC 2.3.1.21
  • CPT II
  • CPT1
  • CPTASE

Background

The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CPT1A Antibody
NB100-53791
Western Blot: CPT1A Antibody [NB100-53791] - Staining of MCF7 cell lysate (35 ug protein in RIPA buffer). Antibody at 2 ug/mL. Detected by chemiluminescence.
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Fatty Acid
Synthase/FASN Antibod
NB400-114
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Expression of Fatty Acid Synthase in chicken hypothalamus. A: total RNA (1 ug) isolated from different tissues (brain, hypothalamus, liver and muscle) was subjected to RT-PCR using specific primers for chicken Fatty Acid Synthase (GenBank accession JO4485) or ribosomal 18S as a control (GenBank accession AF173612) B: tissue lysates (brain, hypothalmus, liver and muscle) were subjected to Western blot as described in MATERIALS AND METHODS. Blots were incubated with anti-Fatty Acid Synthase antibody and revealed by enhanced chemiluminescence. Picture compliments of Dridi S. et al, Am J Physiol Regul Integr Comp Physiol. 2006 Jul;291(1):R138-47. Epub 2006 Feb 2.
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - The Fas antibody was tested in MCF-7 cells at a 1:2000 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
PPAR alpha/NR1C1
Antibody (3B6/PPAR)
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Hek293 cells with PPAR alpha/NR1C1 [3B6/PPAR] Antibody NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
CHPT1
Overexpression Lysate
NBP2-06672
Western Blot: CHPT1 Overexpression Lysate (Adult Normal) [NBP2-06672] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for CHPT1.
Species: Hu
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-84975
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-84975] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P
PPAR gamma/NR1C3
Antibody
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP2-89114
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in SiHa cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:200 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Analysis of paraffin-embedded human kidney tissue using anti-Acetyl CoA Carboxylase 1 (ACC1) antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/200 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Immunocytochemistry/Immunofluorescence: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-89114] - Staining Acetyl CoA Carboxylase 1 (ACC1) in MCF-7 cells (green). Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with the antibody at a dilution of 1:100 for 1 hour at room temperature, washed with PBS. Alexa Fluor(TM) 488 Goat anti-Rabbit IgG was used as the secondary antibody at 1/100 dilution. The nuclear counter stain is DAPI (blue).
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AMPK alpha 1
Antibody (2B7)
NBP2-22127
Western Blot: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Ability to combat ROS varies across cell lines. Western blot analysis showing levels of AMPK and activated AMPK (T172) at 24, 48 and 72 hours following exposure to 0.4 uM GNE-617. Full-length western blots are shown in S2D Fig. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0164166), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunofluorescence analysis of NTERA-2 cells using AMPK alpha 1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunohistochemical analysis of paraffin-embedded ovarian cancer (left) and brain tissues (right) using AMPK alpha 1 mouse mAb with DAB staining.
(9 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
CPT1B Antibody
NBP1-59576
Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color
Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200
Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
ACADVL Antibody
(5D3)
H00000037-M01
Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - ACADVL monoclonal antibody (M01), clone 5D3 Analysis of ACADVL expression in Hela S3 NE.
Immunohistochemistry-Paraffin: ACADVL Antibody (5D3) [H00000037-M01] - Analysis of monoclonal antibody to ACADVL on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Western Blot: ACADVL Antibody (5D3) [H00000037-M01] - Alcohol feeding showed no significant effect on the expression of ACADVL in mouse liver. Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
OCTN2/SLC22A5
Antibody
NBP2-93859
Immunohistochemistry-Paraffin: OCTN2/SLC22A5 Antibody [NBP2-93859] - Paraffin-embedded mouse brain using OCTN2/SLC22A5.
Immunohistochemistry-Paraffin: OCTN2/SLC22A5 Antibody [NBP2-93859] - Paraffin-embedded rat brain using OCTN2/SLC22A5.
Species: Hu, Mu, Rt
Applications: WB, IHC
CD36 Antibody
NB400-144
Immunohistochemistry: CD36 Antibody [NB400-144] - Timp4-deficiency results in defective lipid digestion and absorption. (B) Immunostaining for CD36 in small intestine (proximal region) of chow-fed and HFD-fed WT and Timp4-/- mice. Western blot (C) and mRNA (D) for CD36 in enterocyte fraction of chow-fed and HFD-fed WT and Timp4-/- mice (collected from the proximal small intestine). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-05951-4), licensed under a CC-BY licence.
Western Blot: CD36 Antibody [NB400-144] - Total protein from Human Skin and Adipose tissue, Mouse Adipose and Rat Adipose tissue was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-CD36 in 5% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: CD36 Antibody [NB400-144] - Staining of CD36 in human adipocytes.
(8 Reviews)
(79 Publications)
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CPT2 Antibody (H00001376-M02) (0)

There are no publications for CPT2 Antibody (H00001376-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT2 Antibody (H00001376-M02) (0)

There are no reviews for CPT2 Antibody (H00001376-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPT2 Antibody (H00001376-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

CPT2 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CPT2 Products

Bioinformatics Tool for CPT2 Antibody (H00001376-M02)

Discover related pathways, diseases and genes to CPT2 Antibody (H00001376-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT2 Antibody (H00001376-M02)

Discover more about diseases related to CPT2 Antibody (H00001376-M02).
 

Pathways for CPT2 Antibody (H00001376-M02)

View related products by pathway.

PTMs for CPT2 Antibody (H00001376-M02)

Learn more about PTMs related to CPT2 Antibody (H00001376-M02).

Blogs on CPT2

There are no specific blogs for CPT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPT2 Antibody (1G7) and receive a gift card or discount.


Bioinformatics

Gene Symbol CPT2
Entrez
OMIM
Uniprot