CPT2 Antibody (1E10.)

Images

 
Sandwich ELISA: CPT2 Antibody (1E10) [H00001376-M01] - Detection limit for recombinant GST tagged CPT2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CPT2 Antibody (1E10.) Summary

Immunogen
CPT2 (AAH05172, 351 a.a. - 450 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CPT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPT2 Antibody (1E10.)

  • carnitine O-palmitoyltransferase 2, mitochondrial
  • carnitine palmitoyltransferase 2
  • Carnitine palmitoyltransferase IIEC 2.3.1.21
  • CPT II
  • CPT1
  • CPTASE

Background

The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-06672
Species: Hu
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-57222
Species: Hu
Applications: ICC/IF
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CPT2 Antibody (H00001376-M01) (0)

There are no publications for CPT2 Antibody (H00001376-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPT2 Antibody (H00001376-M01) (0)

There are no reviews for CPT2 Antibody (H00001376-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CPT2 Antibody (H00001376-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPT2 Products

Bioinformatics Tool for CPT2 Antibody (H00001376-M01)

Discover related pathways, diseases and genes to CPT2 Antibody (H00001376-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPT2 Antibody (H00001376-M01)

Discover more about diseases related to CPT2 Antibody (H00001376-M01).
 

Pathways for CPT2 Antibody (H00001376-M01)

View related products by pathway.

PTMs for CPT2 Antibody (H00001376-M01)

Learn more about PTMs related to CPT2 Antibody (H00001376-M01).

Blogs on CPT2

There are no specific blogs for CPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPT2 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CPT2
Uniprot