CPSF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CPSF4 Antibody [NBP2-13868] Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and mitochondria.
Immunohistochemistry-Paraffin: CPSF4 Antibody [NBP2-13868] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPSF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACG KGGMCPFRHISGEKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPSF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
CPSF4 Protein (NBP2-13868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPSF4 Antibody

  • 30kD
  • cleavage and polyadenylation specific factor 4, 30kD subunit
  • cleavage and polyadenylation specific factor 4, 30kDa
  • CPSF 30 kDa subunit
  • neb-1
  • No arches homolog
  • no arches-like zinc finger protein
  • NS1 effector domain-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-20145
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-15318
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-13868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CPSF4 Antibody (NBP2-13868) (0)

There are no publications for CPSF4 Antibody (NBP2-13868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF4 Antibody (NBP2-13868) (0)

There are no reviews for CPSF4 Antibody (NBP2-13868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CPSF4 Antibody (NBP2-13868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPSF4 Products

Bioinformatics Tool for CPSF4 Antibody (NBP2-13868)

Discover related pathways, diseases and genes to CPSF4 Antibody (NBP2-13868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CPSF4

There are no specific blogs for CPSF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPSF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF4