CPSF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CPSF1 Antibody [NBP2-56229] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPSF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHWLLVTGRGALRLHPMAIDGPVDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVYAVATSTNTPCARIPRMTGEEKEFETIERDERYIHPQQEAFSIQLISPVSWEAIPNARIELQEWE
Specificity
Specificity of human CPSF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPSF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CPSF1 Recombinant Protein Antigen (NBP2-56229PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CPSF1 Antibody

  • cleavage and polyadenylation specific factor 1, 160kD subunit
  • cleavage and polyadenylation specific factor 1, 160kDa
  • Cleavage and polyadenylation specificity factor 160 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 1
  • CPSF 160 kDa subunit
  • CPSF160
  • HSU37012
  • P/cl.18
  • polyadenylation specificity factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
DDX0700P-100
Species: Hu, Ca
Applications: Flow, IP, B/N
H00008189-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-24643
Species: Mu, Rt
Applications: WB
H00007884-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-17179
Species: Hu
Applications: WB, ICC/IF
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for CPSF1 Antibody (NBP2-56229) (0)

There are no publications for CPSF1 Antibody (NBP2-56229).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPSF1 Antibody (NBP2-56229) (0)

There are no reviews for CPSF1 Antibody (NBP2-56229). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CPSF1 Antibody (NBP2-56229) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CPSF1 Products

Bioinformatics Tool for CPSF1 Antibody (NBP2-56229)

Discover related pathways, diseases and genes to CPSF1 Antibody (NBP2-56229). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPSF1 Antibody (NBP2-56229)

Discover more about diseases related to CPSF1 Antibody (NBP2-56229).
 

Pathways for CPSF1 Antibody (NBP2-56229)

View related products by pathway.

PTMs for CPSF1 Antibody (NBP2-56229)

Learn more about PTMs related to CPSF1 Antibody (NBP2-56229).

Blogs on CPSF1

There are no specific blogs for CPSF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPSF1