CPNE8 Antibody

Images

 
Immunohistochemistry: CPNE8 Antibody [NBP1-86255] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CPNE8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPNE8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CPNE8 Protein (NBP1-86255PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPNE8 Antibody

  • copine viii
  • copine VIIIMGC129645
  • copine-8
  • MGC129646

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13531
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87055
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88303
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45513
Species: Hu
Applications: WB, IHC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-83481
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-86255
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for CPNE8 Antibody (NBP1-86255) (0)

There are no publications for CPNE8 Antibody (NBP1-86255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE8 Antibody (NBP1-86255) (0)

There are no reviews for CPNE8 Antibody (NBP1-86255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CPNE8 Antibody (NBP1-86255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPNE8 Products

Bioinformatics Tool for CPNE8 Antibody (NBP1-86255)

Discover related pathways, diseases and genes to CPNE8 Antibody (NBP1-86255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE8 Antibody (NBP1-86255)

Discover more about diseases related to CPNE8 Antibody (NBP1-86255).
 

Pathways for CPNE8 Antibody (NBP1-86255)

View related products by pathway.

Blogs on CPNE8

There are no specific blogs for CPNE8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPNE8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE8