Recombinant Human CPNE3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CPNE3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 164-244 of Human CPNE3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CPNE3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CPNE3 Protein

  • copine IIICPN3KIAA0636
  • copine-3
  • PRO1071

Background

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85827
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-54980
Species: Hu
Applications: WB, ICC/IF
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-87521
Species: Hu
Applications: WB, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
H00008895-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CPNE3 Partial Recombinant Protein (H00008895-Q01) (0)

There are no publications for CPNE3 Partial Recombinant Protein (H00008895-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPNE3 Partial Recombinant Protein (H00008895-Q01) (0)

There are no reviews for CPNE3 Partial Recombinant Protein (H00008895-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPNE3 Partial Recombinant Protein (H00008895-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPNE3 Products

Bioinformatics Tool for CPNE3 Partial Recombinant Protein (H00008895-Q01)

Discover related pathways, diseases and genes to CPNE3 Partial Recombinant Protein (H00008895-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPNE3 Partial Recombinant Protein (H00008895-Q01)

Discover more about diseases related to CPNE3 Partial Recombinant Protein (H00008895-Q01).
 

Pathways for CPNE3 Partial Recombinant Protein (H00008895-Q01)

View related products by pathway.

PTMs for CPNE3 Partial Recombinant Protein (H00008895-Q01)

Learn more about PTMs related to CPNE3 Partial Recombinant Protein (H00008895-Q01).

Blogs on CPNE3

There are no specific blogs for CPNE3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CPNE3 Antibody
NBP1-85939

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CPNE3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CPNE3