CPEB1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CPEB1 Antibody [NBP2-56162] - Staining of human cell line SiHa shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPEB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPEB1 Antibody - BSA Free (NBP2-56162) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-CPEB1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLC
• Predicted Species: Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPEB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot Use in WB reported in scientific literature (PMID:35582707)
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CPEB1 Recombinant Protein Antigen (NBP2-56162PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPEB1 Antibody - BSA Free

• CPEBCEBP
• CPE-binding protein 1
• CPE-BP1
• cytoplasmic polyadenylation element binding protein 1
• cytoplasmic polyadenylation element-binding protein 1
• FLJ13203
• h-CEBP
• hCPEB-1
• MGC34136
• MGC60106

Background

CPEB1 encodes a member of the cytoplasmic polyadenylation element (CPE) binding protein family. This highly conserved protein binds to a specific RNA sequence called the CPE found in the 3' UTR of some mRNAs. Similar proteins in Xenopus and mouse function to induce cytoplasmic polyadenylation of dormant mRNAs with short polyA tails, resulting in their translation. Members of this protein family regulate translation of cyclin B1 during embryonic cell divisions. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPEB1 Antibody (NBP2-56162)(1)

Publication using NBP2-56162

• Wang G, Ji X, Li P, Wang W Human bone marrow mesenchymal stem cell-derived exosomes containing microRNA-425 promote migration, invasion and lung metastasis by down-regulating CPEB1 Regenerative Therapy 2022-06-01 [PMID: 35582707] (WB, Human)

Bioinformatics

• Gene Symbol: CPEB1