Home » COX4 » COX4 Antibodies » COX4 Antibody (CL3497)

COX4 Antibody (CL3497)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: COX4 Antibody (CL3497) [NBP2-78718] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2, mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: COX4 Antibody (CL3497) [NBP2-78718] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2, mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human prostate shows strong cytoplasmic immunoreactivity in epithelial cells.
Genetic Strategies: Western Blot: COX4 Antibody (CL3497) [NBP2-78718] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, ...read more
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human fallopian tube shows strong cytoplasmic positivity in epithelial cells.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human stomach shows strong cytoplasmic immunoreactivity in glandular epithelium cells.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules and glomerulus cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clone
CL3497
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

COX4 Antibody (CL3497) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Epitope
VVKSEDFSLP
Specificity
Specificity of human, rat COX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
COX4I1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for COX4 Antibody (CL3497)

  • COX IV-1
  • COX4
  • COX4-1
  • COX4COXIV
  • COX4I2
  • Cytochrome c oxidase polypeptide IV
  • cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  • cytochrome c oxidase subunit IV isoform 1cytochrome c oxidase subunit IV
  • MGC72016

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Sample(30 ug whole cell lysate)A:HeLa S3 B:Hep G2 15% SDS PAGE, antibody diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: COX5A Antibody [NBP1-32550] - A431.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Paraffin-embedded mouse cervix. COX5A antibody [N1C3] diluted at 1:500.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 ug of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using NB100-56503 at 25 ug/ml for 3 hours at room temperature. Cells were stained using the NorthernLights(TM) 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(52 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-Page: COX8A Recombinant Protein [H00001351-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, ICC/IF
Nrf1 Antibody
(JM89-63)
NBP2-75597
Western Blot: Nrf1 Antibody (JM89-63) [NBP2-75597] - Analysis of NRF1 on Hela cell (1) and mouse heart tissue (2) lysate using anti-NRF1 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: Nrf1 Antibody (JM89-63) [NBP2-75597] - Staining NRF1 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Nrf1 Antibody (JM89-63) [NBP2-75597] - Analysis of paraffin-embedded rat brain tissue using anti-NRF1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
mtTFA Antibody
(18G102B2E11)
NBP1-71648
Western Blot: mtTFA Antibody (18G102B2E11) [NBP1-71648] - MtDNA depletion and reversible impaired immune functions in THP-1A cells. A and B, Treatment with 50A ng/mL ethidium bromide (EtBr) for 8A weeks. Transfection with 30A nmol/L negative or TFAM siRNA for 8A days. TFAM protein relative toI2-actin. D, MtDNA levels. E, LPS-induced TNF-I+-and IL-8 release. Image collected and cropped by Cite Ab from the following publication (Mitochondrial DNA depletion induces innate immune dysfunction rescued by IFN-γ. J Allergy Clin Immunol (2017)) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Immunostaining in HeLa cells. C1: DAPI staining 2 nuclei, C2: anti-mtTFA stain with Alexa Fluor 488 secondary ab (green), C3: Mitotracker Red staining mitochondria. Image courtesy of Elizabeth Wang.
Immunohistochemistry-Paraffin: mtTFA Antibody (18G102B2E11) [NBP1-71648] - IHC staining of mtTFA on human testis using DAB with hematoxylin counterstain.
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
COX IV Isoform 2
Antibody (1F2)
H00084701-M01
Western Blot: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Analysis of COX4I2 expression in transfected 293T cell line by COX4I2 monoclonal antibody (M01), clone 1F2.Lane 1: COX4I2 transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Analysis of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Immunoprecipitation: COX IV Isoform 2 Antibody (1F2) [H00084701-M01] - Analysis of COX4I2 transfected lysate using anti-COX4I2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with COX4I2 MaxPab rabbit polyclonal antibody.
(10 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, IB, IHC, IHC-P, IP, S-ELISA
COX-1 Antibody
NBP1-85500
Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Validation of gene expression changes from RNA-Seq experiments. b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant urothelium (d). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-12332-0), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (1761) [NBP2-43648] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Citrate synthetase protein stained by Citrate synthetase antibody [1761] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:50. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Analysis of mouse kidney. Citrate synthetase antibody [1761] dilution: 1:200.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(29 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
PGC1 alpha Antibody
NBP1-04676
Knockout Validated: PGC1 alpha Antibody [NBP1-04676] - Western blot shows lysates of A431 human squamous carcinoma parental cell line and PGC1 alpha knockout (KO) A431 cell line. PVDF membrane was probed with 1:1000 of Rabbit Polyclonal PGC1 alpha Antibody (Catalog # NBP1-04676) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for PGC1 alpha at approximately 105 kDa (as indicated) in the parental A431 cell line, but is not detectable in the knockout A431 cell line. This experiment was conducted under reducing conditions.
Western Blot: PGC1 alpha Antibody [NBP1-04676] - Total protein from human adipose and skeletal muscle tissue, HeLa and A431 cells lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL PGC1 alpha Antibody (Molecular weight: 91 KDa) in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence
Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - Analysis of PGC1 alpha Antibody in mouse prostate using DAB with hematoxylin counterstain.
(11 Reviews)
(134 Publications)
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
COX5b Antibody
NBP2-92927
Western Blot: COX5b Antibody [NBP2-92927] - Analysis of extracts of various cell lines, using COX5b.Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: COX5b Antibody [NBP2-92927] - Analysis of U-2 OS cells using COX5b at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: COX5b Antibody [NBP2-92927] - Paraffin-embedded mouse heart using COX5b.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Nuclear Factor
Erythroid 2 Related F ...
NBP2-93792
Western Blot: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-93792] - Analysis of extracts of various cell lines, using Nuclear Factor Erythroid 2 Related Factor 1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Immunocytochemistry/Immunofluorescence: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-93792] - Analysis of HeLa cells using Nuclear Factor Erythroid 2 Related Factor 1 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid 2 Related Factor 1 Antibody [NBP2-93792] - Paraffin-embedded rat spleen using Nuclear Factor Erythroid 2 Related Factor 1.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Glut4 Antibody
NBP1-49533
Western Blot: Glut4 Antibody [NBP1-49533] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-Glut4 0.5 ug/ml in non-fat milk. Undiffer: undifferentiated; Differ: Differentiated. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Glut4 Antibody [NBP1-49533] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-GLUT4 [NBP1-49533] at a 1:200 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: Glut4 Antibody [NBP1-49533] - Analysis of GLUT4 in mouse kidney
(4 Reviews)
(18 Publications)
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
HSP60 Antibody
NBP1-77397
Western Blot: HSP60 Antibody [NBP1-77397] - Analysis of extracts from HeLa and COS cells using NBP1-77397 Hsp60 antibody at 1:1000
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - Confocal immunofluorescent analysis of HeLa cells using Hsp60 antibody (NBP1-77397, 1:100). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green, A). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red, B). DAPI was used to stain the cell nuclei (blue, C).
Immunohistochemistry: HSP60 Antibody [NBP1-77397] - Staining of HSP60 in human kidney carcinoma using DAB with hematoxylin counterstain.
(4 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
COX4 Antibody
(CL3497)
NBP2-78718
COX4 Antibody (CL3497)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for COX4 Antibody (NBP2-78718) (0)

There are no publications for COX4 Antibody (NBP2-78718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4 Antibody (NBP2-78718) (0)

There are no reviews for COX4 Antibody (NBP2-78718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX4 Antibody (NBP2-78718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional COX4 Products

Bioinformatics Tool for COX4 Antibody (NBP2-78718)

Discover related pathways, diseases and genes to COX4 Antibody (NBP2-78718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX4 Antibody (NBP2-78718)

Discover more about diseases related to COX4 Antibody (NBP2-78718).
 

Pathways for COX4 Antibody (NBP2-78718)

View related products by pathway.

PTMs for COX4 Antibody (NBP2-78718)

Learn more about PTMs related to COX4 Antibody (NBP2-78718).
 

Research Areas for COX4 Antibody (NBP2-78718)

Find related products by research area.

Blogs on COX4.

Check out the latest blog posts on COX4.
The Importance of the COX IV Antibody to Apoptosis Research
COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX4 Antibody (CL3497) and receive a gift card or discount.


Bioinformatics

Gene Symbol COX4I1