COX4 Antibody (CL3497)

Images

 
Western Blot: COX4 Antibody (CL3497) [NBP2-78718] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431, human cell line HepG2, mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human prostate shows strong cytoplasmic immunoreactivity in epithelial cells.
Genetic Strategies: Western Blot: COX4 Antibody (CL3497) [NBP2-78718] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, ...read more
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human fallopian tube shows strong cytoplasmic positivity in epithelial cells.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human stomach shows strong cytoplasmic immunoreactivity in glandular epithelium cells.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: COX4 Antibody (CL3497) [NBP2-78718] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules and glomerulus cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clone
CL3497
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

COX4 Antibody (CL3497) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Epitope
VVKSEDFSLP
Specificity
Specificity of human, rat COX4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
COX4I1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for COX4 Antibody (CL3497)

  • COX IV-1
  • COX4
  • COX4-1
  • COX4COXIV
  • COX4I2
  • Cytochrome c oxidase polypeptide IV
  • cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  • cytochrome c oxidase subunit IV isoform 1cytochrome c oxidase subunit IV
  • MGC72016

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71648
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
H00084701-M01
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, IB, IHC, IHC-P, IP, S-ELISA
NBP1-85500
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
NBP2-92927
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-93792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NBP2-78718
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for COX4 Antibody (NBP2-78718) (0)

There are no publications for COX4 Antibody (NBP2-78718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4 Antibody (NBP2-78718) (0)

There are no reviews for COX4 Antibody (NBP2-78718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX4 Antibody (NBP2-78718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COX4 Products

Bioinformatics Tool for COX4 Antibody (NBP2-78718)

Discover related pathways, diseases and genes to COX4 Antibody (NBP2-78718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX4 Antibody (NBP2-78718)

Discover more about diseases related to COX4 Antibody (NBP2-78718).
 

Pathways for COX4 Antibody (NBP2-78718)

View related products by pathway.

PTMs for COX4 Antibody (NBP2-78718)

Learn more about PTMs related to COX4 Antibody (NBP2-78718).
 

Research Areas for COX4 Antibody (NBP2-78718)

Find related products by research area.

Blogs on COX4.

The Importance of the COX IV Antibody to Apoptosis Research
COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX4 Antibody (CL3497) and receive a gift card or discount.

Bioinformatics

Gene Symbol COX4I1