COX18 Antibody

Images

 
Immunohistochemistry: COX18 Antibody [NBP2-30593] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear staining in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COX18 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AYQHYILAKVENLQPEIKTIARHLNQEVAVRANQLGWSKRDARLTYLKNMRRLISELYVRDNC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
COX18 Protein (NBP2-30593PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX18 Antibody

  • COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
  • COX18HS
  • Cox18Hs1 protein
  • Cox18Hs2 protein
  • Cox18Hs3 protein
  • Cytochrome c oxidase assembly protein 18
  • FLJ38991
  • MGC126733
  • mitochondrial COX18
  • mitochondrial inner membrane protein COX18
  • OXA1L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82769
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91886
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32276
Species: Hu
Applications: WB, IP
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97491
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for COX18 Antibody (NBP2-30593) (0)

There are no publications for COX18 Antibody (NBP2-30593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX18 Antibody (NBP2-30593) (0)

There are no reviews for COX18 Antibody (NBP2-30593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COX18 Antibody (NBP2-30593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX18 Products

Bioinformatics Tool for COX18 Antibody (NBP2-30593)

Discover related pathways, diseases and genes to COX18 Antibody (NBP2-30593). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX18 Antibody (NBP2-30593)

Discover more about diseases related to COX18 Antibody (NBP2-30593).
 

Pathways for COX18 Antibody (NBP2-30593)

View related products by pathway.

PTMs for COX18 Antibody (NBP2-30593)

Learn more about PTMs related to COX18 Antibody (NBP2-30593).

Blogs on COX18

There are no specific blogs for COX18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX18
Uniprot