COX19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COX19 Antibody [NBP1-82769] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: COX19 Antibody [NBP1-82769] - Staining in human fallopian tube and liver tissues.. Corresponding COX19 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: COX19 Antibody [NBP1-82769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: COX19 Antibody [NBP1-82769] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: COX19 Antibody [NBP1-82769] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: COX19 Antibody [NBP1-82769] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

COX19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COX19 Protein (NBP1-82769PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COX19 Antibody

  • COX19 cytochrome c oxidase assembly homolog (S. cerevisiae)
  • cytochrome c oxidase assembly protein COX19
  • hCOX19
  • MGC104475

Background

COX19 encodes a cytochrome c oxidase (COX)-assembly protein. The S. cerevisiae Cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX19 Antibody (NBP1-82769) (0)

There are no publications for COX19 Antibody (NBP1-82769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX19 Antibody (NBP1-82769) (0)

There are no reviews for COX19 Antibody (NBP1-82769). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COX19 Antibody (NBP1-82769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX19