Home » COX11 » COX11 Antibodies » COX11 Antibody

COX11 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.
Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

COX11 Antibody Summary

Immunogen
COX11 (AAH05895, 1 a.a. - 276 a.a.) full-length human protein. MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
COX11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
This antibody is useful for WB. ICC/IF usage reported in scientific literature (PMID: 25725288).
Publications
Read Publication using
H00001353-B02P in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX11 Antibody

  • COX11 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX11 cytochrome c oxidase assembly homolog (yeast)
  • COX11 homolog, cytochrome c oxidase assembly protein
  • COX11P
  • cytochrome c oxidase assembly protein COX11, mitochondrial
  • cytochrome c oxidase subunit 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Using the Alexa Fluor 488 direct conjugate, an intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503AF488 (blue) and a matched isotype control NBP2-27231AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): Cytochrome c Antibody (7H8.2C12) [NB100-56503] - An intracellular stain was performed on HeLa cells with Cytochrome c (7H8.2C12) antibody NB100-56503PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to phycoerythrin.
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Metformin activates apoptotic cell death; Right panel: MCF-7 cells were kept in the presence or absence of metformin for 20 days and then processed to obtain mitochondrial or whole cellular extracts. BAX and CYCS expression levels were determined by Western blot as indicated under Material and Methods. Densitometric analysis of the gels was performed as indicated under Material and Methods. PHB and CDK4 were used as purity and loading controls. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/2073-4409/8/1/49), licensed under a CC-BY licence.
(58 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
SCO1 Antibody
NBP1-87073
Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human cerebral cortex, colon, kidney and liver using Anti-SCO1 antibody NBP1-87073 (A) shows similar protein distribution across tissues to independent antibody NBP1-87074 (B).
Western Blot: SCO1 Antibody [NBP1-87073] - Analysis using Anti-SCO1 antibody NBP1-87073 (A) shows similar pattern to independent antibody NBP1-87074 (B).
Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human cerebral cortex.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
COX17 Antibody
NBP2-99469
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human liver with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunoprecipitation: COX17 Antibody [NBP2-99469] - COX17 was immunoprecipitated using: Lane A: 0.5 mg mouse kidney tissue Lysate 4 ul anti-COX17 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads. Protein A/G. Primary antibody: Anti-COX17 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 88 kDa. Observed band size: 130 kDa
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
SCO2 Antibody -
BSA Free
NBP1-77274
Immunohistochemistry-Paraffin: SCO2 Antibody [NBP1-77274] - Human liver tissue with SCO2 antibody at 2.5 ug/ml.
Immunofluorescence: SCO2 Antibody [NBP1-77274] - Human Liver tissue with SCO2 antibody at 20 ug/mL.
Western Blot: SCO2 Antibody [NBP1-77274] - Analysis in HL60 cell lysate lysate with antibody at (A) 1 and (B) 2 ug/mL.
Species: Hu
Applications: ELISA, IF, IHC, IHC-P, WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
COX10 Antibody
NBP1-86322
Western Blot: COX10 Antibody [NBP1-86322] - Analysis in control (vector only transfected HEK293T lysate) and COX10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: COX10 Antibody [NBP1-86322] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: COX10 Antibody [NBP1-86322] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-Page: COX8A Recombinant Protein [H00001351-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with COX5A antibody [N1C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.
Western Blot: COX5A Antibody [NBP1-32550] - Sample(30 ug whole cell lysate)A:HeLa S3 B:Hep G2 15% SDS PAGE, antibody diluted at 1:5000.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TOX3 Antibody
(TOX3/1123)
NBP2-45165
Immunofluorescence: TOX3 Antibody (TOX3/1123) [NBP2-45165] - E4.5 embryonic chicken neural tube. TOX3 antibody at 1:200 dilution. IF image submitted by a verified customer review.
Western Blot: TOX3 Antibody (TOX3/1123) [NBP2-45165] - Western Blot Analysis of A431 cell lysate using TOX3 Mouse Monoclonal Antibody (TOX3/1123).
Protein Array: TOX3 Antibody (TOX3/1123) [NBP2-45165] - Analysis of Protein Array containing more than 19,000 full-length human proteins using TOX3 Mouse Monoclonal Antibody (TOX3/1123).
(1 Review)
Species: Ch, Hu
Applications: ELISA, IF, IHC, IHC-P, PA, WB
SLC4A7/Sodium
bicarbonate cotranspo ...
NBP1-87850
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Analysis in human duodenum and liver tissues. Corresponding SLC4A7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human tonsil shows moderate to strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human liver shows no positivity in hepatocytes.
Species: Hu
Applications: IHC, IHC-P
FGFR2 Antibody
(OTI5C5)
NBP2-00932
Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - Analysis of Hela cells, using anti-FGFR2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-FGFR2 antibody, and then analyzed by flow cytometry.
Western Blot: FGFR2 Antibody (5C5) [NBP2-00932] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FGFR2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FGFR2.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
COX15 Antibody
NBP1-59560
Western Blot: COX15 Antibody [NBP1-59560] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: COX15 Antibody [NBP1-59560] - Lanes: Lane1 : 20 ug human fibroblast mitochondria Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: COX15.
Species: Hu
Applications: IHC, IHC-P, WB
LSP1 Antibody -
BSA Free
NBP1-74048
Immunohistochemistry-Paraffin: LSP1 Antibody [NBP1-74048] - IHC analysis of LSP1 in mouse colon tissue. Abundant membrane staining is visible in the epithelial cells.
Western Blot: LSP1 Antibody [NBP1-74048] - Western blot analysis of LSP1 in Ramos (1) and Daudi (2) cell lysates.
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PRP19 Antibody
(SC06-53)
NBP2-67597
Flow Cytometry: PRP19 Antibody (SC06-53) [NBP2-67597] - Analysis of Hela cells with PRP19 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PRP19 Antibody (SC06-53) [NBP2-67597] - Staining PRP19 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PRP19 Antibody (SC06-53) [NBP2-67597] - Staining PRP19 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SNM1 Antibody
NBP1-89663
Immunohistochemistry-Paraffin: SNM1 Antibody [NBP1-89663] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunocytochemistry: SNM1 Antibody [NBP1-89663] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COX-1 Antibody
NBP1-85500
Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining of human skin shows high expression.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Analysis of Mouse Lung showing detection of >150 kDa Copper Transporting ATPase 1 protein using clone S60-4. 10 ug of sample was loaded and primary antibody was used at 1:1000. Predicted/Observed Size: ~160 kDa. Other band(s): 250 kDa.
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Western Blot analysis of Rat Liver showing detection of ~180 kDa ATP7A protein using Mouse Anti-ATP7A Monoclonal Antibody, Clone S60-4 (NBP2-59376). Lane 1: MW Ladder. Lane 2: Rat Liver . Load: 10 ug. Block: 5% Skim Milk powder in TBST. Primary Antibody: Mouse ATP7A Monoclonal Antibody (NBP2-59376) at 1:500 for 2 hours at RT with shaking. Secondary Antibody: Goat anti-mouse IgG:HRP at 1:4000 for 1 hour at RT with shaking. Color Development: Chemiluminescent for HRP (Moss) for 5 min in RT. Predicted/Observed Size: ~180 kDa.
Immunocytochemistry/Immunofluorescence: ATP7A Antibody (S60-4) [NBP2-59376] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody, Clone S60-4 (NBP2-59376). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody (NBP2-59376) at 1:100 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Copper Transporting ATPase 1 Antibody (D) Composite.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MEKK1 Antibody
NBP3-02962
Immunocytochemistry/Immunofluorescence: MEKK1 Antibody [NBP3-02962] - Analysis of L929 cells using MEKK1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MEKK1 Antibody [NBP3-02962] - Paraffin-embedded human liver using MEKK1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: MEKK1 Antibody [NBP3-02962] - Paraffin-embedded rat liver using MEKK1 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RanBP2 Antibody
NB120-2938
Western Blot: RanBP2 Antibody [NB120-2938] - Effect of hypoxia on the interaction between HIF1alpha and BICD1. Co-immunoprecipitation of HIF1alpha, Dynein IC, Importin alpha3, RanBP2 with IgG and BICD1 antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1) licensed under a CC-BY licence.
Immunohistochemistry: RanBP2 Antibody [NB120-2938] - Figure 1 illustrates immunohistochemical staining of RanBP2 in bovine retina using NB120-2938. Figure 2 illustrates Western blot detection of RanBP2 from human retinal extracts using NB120-2938.
Western Blot: RanBP2 Antibody [NB120-2938] - Analysis of human retinal extracts.
(2 Publications)
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB

Publications for COX11 Antibody (H00001353-B02P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for COX11 Antibody (H00001353-B02P) (0)

There are no reviews for COX11 Antibody (H00001353-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX11 Antibody (H00001353-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX11 Products

Bioinformatics Tool for COX11 Antibody (H00001353-B02P)

Discover related pathways, diseases and genes to COX11 Antibody (H00001353-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX11 Antibody (H00001353-B02P)

Discover more about diseases related to COX11 Antibody (H00001353-B02P).
 

Pathways for COX11 Antibody (H00001353-B02P)

View related products by pathway.

PTMs for COX11 Antibody (H00001353-B02P)

Learn more about PTMs related to COX11 Antibody (H00001353-B02P).
 

Research Areas for COX11 Antibody (H00001353-B02P)

Find related products by research area.

Blogs on COX11

There are no specific blogs for COX11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol COX11
Uniprot