Home » COX11 » COX11 Antibodies » COX11 Antibody

COX11 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.
Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

COX11 Antibody Summary

Immunogen
COX11 (AAH05895, 1 a.a. - 276 a.a.) full-length human protein. MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
COX11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is useful for WB. ICC/IF usage reported in scientific literature (PMID: 25725288).
Publications
Read Publication using
H00001353-B02P in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX11 Antibody

  • COX11 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX11 cytochrome c oxidase assembly homolog (yeast)
  • COX11 homolog, cytochrome c oxidase assembly protein
  • COX11P
  • cytochrome c oxidase assembly protein COX11, mitochondrial
  • cytochrome c oxidase subunit 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytochrome c
Antibody (7H8.2C12)
NB100-56503
Western Blot: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Analysis using the biotin conjugate of NB100-56503. Detection of Cytochrome C in 15 ug of HeLa cell lysate using NB100-55775 at 1:1000. A 15 kDa band is detected.
Immunocytochemistry/Immunofluorescence: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - p73 was detected in immersion fixed Hela human cell line using NB100-56503 at 25 ug/ml for 3 hours at room temperature. Cells were stained using the NorthernLights(TM) 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and mitochondria.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (7H8.2C12) [NB100-56503] - Cytochrome C was detected in immersion fixed paraffin-embedded sections of human heart using anti-human mouse monoclonal antibody (Catalog # NB100-56503) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(52 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
SCO1 Antibody
NBP1-87073
Western Blot: SCO1 Antibody [NBP1-87073] - Analysis using Anti-SCO1 antibody NBP1-87073 (A) shows similar pattern to independent antibody NBP1-87074 (B).
Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human kidney.
Immunohistochemistry-Paraffin: SCO1 Antibody [NBP1-87073] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
COX17 Antibody
NBP2-99469
Western Blot: COX17 Antibody [NBP2-99469] - Anti-COX17 rabbit polyclonal antibody at 1:500 dilution. Lane A: HepG2 Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 7 kDa
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human testis with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: COX17 Antibody [NBP2-99469] - Immunochemical staining of human COX17 in human liver with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: WB, IHC, IHC-P, IP
SCO2 Antibody
NBP1-77274
Western Blot: SCO2 Antibody [NBP1-77274] - Analysis in HL60 cell lysate lysate with antibody at (A) 1 and (B) 2 ug/mL.
Immunohistochemistry-Paraffin: SCO2 Antibody [NBP1-77274] - Human liver tissue with SCO2 antibody at 2.5 ug/ml.
Immunofluorescence: SCO2 Antibody [NBP1-77274] - Human Liver tissue with SCO2 antibody at 20 ug/mL.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IF
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, ICC/IF
COX10 Antibody
NBP1-86322
Western Blot: COX10 Antibody [NBP1-86322] - Analysis in control (vector only transfected HEK293T lysate) and COX10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: COX10 Antibody [NBP1-86322] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria.
Immunohistochemistry-Paraffin: COX10 Antibody [NBP1-86322] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-Page: COX8A Recombinant Protein [H00001351-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with COX5A antibody [N1C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: COX5A Antibody [NBP1-32550] - A431.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Paraffin-embedded mouse cervix. COX5A antibody [N1C3] diluted at 1:500.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TOX3 Antibody
(TOX3/1123)
NBP2-45165
Immunohistochemistry-Paraffin: TOX3 Antibody (TOX3/1123) [NBP2-45165] - Human Gastric Carcinoma stained with TOX3 Monoclonal Antibody (TOX3/1123).
Immunohistochemistry-Paraffin: TOX3 Antibody (TOX3/1123) [NBP2-45165] - Human Cervical Carcinoma stained with TOX3 Monoclonal Antibody (TOX3/1123).
Immunohistochemistry-Paraffin: TOX3 Antibody (TOX3/1123) [NBP2-45165] - Human Gall Bladder stained with TOX3 Monoclonal Antibody (TOX3/1123).
(1 Review)
Species: Hu, Ch
Applications: Flow, IHC, IHC-P, IF
SLC4A7/Sodium
bicarbonate cotranspo ...
NBP1-87850
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Analysis in human duodenum and liver tissues. Corresponding SLC4A7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human tonsil shows moderate to strong membranous positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
FGFR2 Antibody
(OTI5C5)
NBP2-00932
Western Blot: FGF R2 Antibody (5C5) [NBP2-00932] - Analysis of FGF R2 in HEK293T cells (left, control) and HEK293T cells overexpressing FGF R2 (right) using anti-FGF R2 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: FGFR2 Antibody (5C5) [NBP2-00932] Staining of COS7 cells transiently transfected by pCMV6-ENTRY FGFR2.
Immunohistochemistry-Paraffin: FGFR2 Antibody (5C5) [NBP2-00932] - Staining of paraffin-embedded Human endometrium tissue using anti-FGFR2 mouse monoclonal antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
COX15 Antibody
NBP1-59560
Western Blot: COX15 Antibody [NBP1-59560] - Lanes: Lane1 : 20 ug human fibroblast mitochondria Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: COX15.
Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: COX15 Antibody [NBP1-59560] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.
Species: Hu
Applications: WB, IHC, IHC-P
LSP1 Antibody
NBP1-74048
Western Blot: LSP1 Antibody [NBP1-74048] - Western blot analysis of LSP1 in Ramos (1) and Daudi (2) cell lysates.
Immunohistochemistry-Paraffin: LSP1 Antibody [NBP1-74048] - IHC analysis of LSP1 in mouse colon tissue. Abundant membrane staining is visible in the epithelial cells.
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of SOD in liver lysate of 1) human, 2) mouse, and 3) rat using this antibody. 025 ug/ml.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
PRP19 Antibody
(SC06-53)
NBP2-67597
Western Blot: PRP19 Antibody (SC06-53) [NBP2-67597] - Analysis of PRP19 on Jurkat cells lysates using anti-PRP19 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: PRP19 Antibody (SC06-53) [NBP2-67597] - Staining PRP19 in B16-F1 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PRP19 Antibody (SC06-53) [NBP2-67597] - Analysis of paraffin-embedded mouse kidney tissue using anti-PRP19 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SNM1 Antibody
NBP1-89663
Immunocytochemistry: SNM1 Antibody [NBP1-89663] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: SNM1 Antibody [NBP1-89663] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COX-1 Antibody
NBP1-85500
Immunohistochemistry-Paraffin: COX-1 Antibody [NBP1-85500] - Staining in human skin and skeletal muscle tissues using anti-PTGS1 antibody. Corresponding PTGS1 RNA-seq data are presented for the same tissues.
Western Blot: COX-1 Antibody [NBP1-85500] - Analysis in human cell line HELA.
Immunocytochemistry/Immunofluorescence: COX-1 Antibody [NBP1-85500] - Validation of gene expression changes from RNA-Seq experiments. b, d Cox1 and Krt5 expression in a control (b) and in the ShhCre;Ppargfl/fl mutant urothelium (d). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-019-12332-0), licensed under a CC-BY licence.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
ATP7A Antibody
(S60-4)
NBP2-59376
Western Blot: ATP7A Antibody (S60-4) [NBP2-59376] - Analysis of Mouse Lung showing detection of >150 kDa Copper Transporting ATPase 1 protein using clone S60-4. 10 ug of sample was loaded and primary antibody was used at 1:1000. Predicted/Observed Size: ~160 kDa. Other band(s): 250 kDa.
Immunocytochemistry/Immunofluorescence: ATP7A Antibody (S60-4) [NBP2-59376] - Tissue: NIH 3T3 (Mouse Fibroblast cell line). Species: Mouse. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Copper Transporting ATPase 1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Endoplasmic Reticulum, Cytoplasm, Golgi Apparatus, Trans-Golgi Network Membrane, Cell Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
MEKK1 Antibody
(2F6) - Azide and BSA ...
NBP2-47810
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, IF
RanBP2 Antibody
NB120-2938
Western Blot: RanBP2 Antibody [NB120-2938] - Effect of hypoxia on the interaction between HIF1alpha and BICD1. Co-immunoprecipitation of HIF1alpha, Dynein IC, Importin alpha3, RanBP2 with IgG and BICD1 antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1) licensed under a CC-BY licence.
Immunohistochemistry: RanBP2 Antibody [NB120-2938] - Figure 1 illustrates immunohistochemical staining of RanBP2 in bovine retina using NB120-2938. Figure 2 illustrates Western blot detection of RanBP2 from human retinal extracts using NB120-2938.
Western Blot: RanBP2 Antibody [NB120-2938] - Analysis of human retinal extracts.
(2 Publications)
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P

Publications for COX11 Antibody (H00001353-B02P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for COX11 Antibody (H00001353-B02P) (0)

There are no reviews for COX11 Antibody (H00001353-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX11 Antibody (H00001353-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional COX11 Products

Bioinformatics Tool for COX11 Antibody (H00001353-B02P)

Discover related pathways, diseases and genes to COX11 Antibody (H00001353-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX11 Antibody (H00001353-B02P)

Discover more about diseases related to COX11 Antibody (H00001353-B02P).
 

Pathways for COX11 Antibody (H00001353-B02P)

View related products by pathway.

PTMs for COX11 Antibody (H00001353-B02P)

Learn more about PTMs related to COX11 Antibody (H00001353-B02P).

Blogs on COX11

There are no specific blogs for COX11, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol COX11
Uniprot