COX11 Antibody

Images

 
Western Blot: COX11 Antibody [H00001353-B02P] - Analysis of COX11 expression in transfected 293T cell line by COX11 polyclonal antibody. Lane 1: COX11 transfected lysate(30.47 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COX11 Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
COX11 (AAH05895, 1 a.a. - 276 a.a.) full-length human protein. MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
COX11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
This antibody is useful for WB. ICC/IF usage reported in scientific literature (PMID: 25725288).
Publications
Read Publication using
H00001353-B02P in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX11 Antibody

  • COX11 (yeast) homolog, cytochrome c oxidase assembly protein
  • COX11 cytochrome c oxidase assembly homolog (yeast)
  • COX11 homolog, cytochrome c oxidase assembly protein
  • COX11P
  • cytochrome c oxidase assembly protein COX11, mitochondrial
  • cytochrome c oxidase subunit 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COX11 Antibody (H00001353-B02P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for COX11 Antibody (H00001353-B02P) (0)

There are no reviews for COX11 Antibody (H00001353-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COX11 Antibody (H00001353-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX11 Products

Research Areas for COX11 Antibody (H00001353-B02P)

Find related products by research area.

Blogs on COX11

There are no specific blogs for COX11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COX11
Uniprot