COX IV Isoform 2 Antibody - Azide and BSA Free

Western Blot: COX IV Isoform 2 Antibody [H00084701-D01P] - Analysis of COX4I2 expression in transfected 293T cell line by COX4I2 polyclonal antibody.Lane 1: COX4I2 transfected lysate(20.00 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COX IV Isoform 2 Antibody - Azide and BSA Free Summary

• Immunogen: COX4I2 (NP_115998.2, 1 a.a. - 171 a.a.) full-length human protein. MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
• Specificity: Reacts with cytochrome c oxidase subunit IV isoform 2 (lung).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COX4I2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX IV Isoform 2 Antibody - Azide and BSA Free

• COX IV-2
• COX4
• COX4-2
• COX4B
• COX4-I2
• COX4L2
• COXIV-2
• cytochrome c oxidase subunit 4 isoform 2, mitochondrial
• cytochrome c oxidase subunit IV isoform 2 (lung)
• Cytochrome c oxidase subunit IV isoform 2
• cytochrome c oxidase subunit IV-like 2
• dJ857M17.2

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX4I2
• Entrez:
  • 84701(Human)
• Uniprot:
  • NP_115998.2(Human)