Recombinant Human COUP-TF I/NR2F1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COUP-TF I/NR2F1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 141-240 of Human NR2F1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF

Protein/Peptide Type
Partial Recombinant Protein
Gene
NR2F1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COUP-TF I/NR2F1 Protein

  • COUP transcription factor 1
  • COUPTF I
  • COUP-TF I
  • COUP-TF1
  • COUP-TFI
  • EAR-3COUP transcription factor I
  • EAR3COUP-TF I
  • ERBAL3
  • ERBAL3V-erbA-related protein 3
  • NR2F1
  • Nuclear receptor subfamily 2 group F member 1
  • nuclear receptor subfamily 2, group F, member 1
  • SVP44
  • TCFCOUP1
  • TFCOUP1NR2F2
  • transcription factor COUP 1 (chicken ovalbumin upstream promoter 1, v-erb-ahomolog-like 3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-24510
Species: Hu, Ca, Pm
Applications: WB
AF4186
Species: Hu
Applications: WB, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007025-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01) (0)

There are no publications for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01) (0)

There are no reviews for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COUP-TF I/NR2F1 Products

Bioinformatics Tool for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01)

Discover related pathways, diseases and genes to COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01)

Discover more about diseases related to COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01).
 

Pathways for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01)

View related products by pathway.

PTMs for COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01)

Learn more about PTMs related to COUP-TF I/NR2F1 Partial Recombinant Protein (H00007025-Q01).

Blogs on COUP-TF I/NR2F1

There are no specific blogs for COUP-TF I/NR2F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COUP-TF I/NR2F1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR2F1
Entrez