Cornulin Antibody

Images

 
Immunohistochemistry: Cornulin Antibody [NBP1-88479] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cornulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRNN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cornulin Protein (NBP1-88479PEP)
Publications
Read Publication using NBP1-88479.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cornulin Antibody

  • 53 kDa squamous epithelial-induced stress protein
  • 58 kDa heat shock protein
  • C1orf10
  • chromosome 1 open reading frame 10
  • Cornulin
  • CRNN
  • DRC1
  • Gm1015
  • PDRC1
  • PDRC1,53 kDa putative calcium-binding protein
  • SEP53
  • SEP53C1orf10
  • Squamous epithelial heat shock protein 53
  • Tumor-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4604
Species: Hu
Applications: WB, IHC
NBP1-80687
Species: Hu
Applications: IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF123
Species: Hu
Applications: WB, Block, ICC
NBP1-86019
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cornulin Antibody (NBP1-88479)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-88479 Applications Species
Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010

Reviews for Cornulin Antibody (NBP1-88479) (0)

There are no reviews for Cornulin Antibody (NBP1-88479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cornulin Antibody (NBP1-88479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cornulin Products

Bioinformatics Tool for Cornulin Antibody (NBP1-88479)

Discover related pathways, diseases and genes to Cornulin Antibody (NBP1-88479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cornulin Antibody (NBP1-88479)

Discover more about diseases related to Cornulin Antibody (NBP1-88479).
 

Pathways for Cornulin Antibody (NBP1-88479)

View related products by pathway.

Blogs on Cornulin

There are no specific blogs for Cornulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cornulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRNN
Entrez