Corneodesmosin Antibody (5B4)

Images

 
Western Blot: Corneodesmosin Antibody (5B4) [H00001041-M02] - Detection against Immunogen (31.24 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Corneodesmosin Antibody (5B4) Summary

Immunogen
CDSN (NP_001255 306 a.a. - 355 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDSN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Corneodesmosin Antibody (5B4)

  • CDSN
  • Corneodesmosin
  • D6S586E
  • differentiated keratinocyte S protein
  • HTSS
  • S protein
  • S

Background

This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-04611
Species: Hu
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Corneodesmosin Antibody (H00001041-M02) (0)

There are no publications for Corneodesmosin Antibody (H00001041-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Corneodesmosin Antibody (H00001041-M02) (0)

There are no reviews for Corneodesmosin Antibody (H00001041-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Corneodesmosin Antibody (H00001041-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Corneodesmosin Products

Bioinformatics Tool for Corneodesmosin Antibody (H00001041-M02)

Discover related pathways, diseases and genes to Corneodesmosin Antibody (H00001041-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Corneodesmosin Antibody (H00001041-M02)

Discover more about diseases related to Corneodesmosin Antibody (H00001041-M02).
 

Pathways for Corneodesmosin Antibody (H00001041-M02)

View related products by pathway.

PTMs for Corneodesmosin Antibody (H00001041-M02)

Learn more about PTMs related to Corneodesmosin Antibody (H00001041-M02).

Blogs on Corneodesmosin

There are no specific blogs for Corneodesmosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Corneodesmosin Antibody (5B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDSN
Entrez
Uniprot