COQ9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COQ9 Antibody [NBP1-88450] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: COQ9 Antibody [NBP1-88450] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COQ9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COQ9 Protein (NBP1-88450PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COQ9 Antibody

  • C16orf49DKFZp434K046
  • chromosome 16 open reading frame 49
  • coenzyme Q9 homolog (S. cerevisiae)
  • coenzyme Q9 homolog (yeast)
  • DKFZP434K046
  • ubiquinone biosynthesis protein COQ9, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP2-55409
Species: Hu
Applications: WB, ICC/IF
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91806
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000141-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-57573
Species: Hu
Applications: ICC/IF
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13865
Species: Hu
Applications: IHC, IHC-P
NBP1-92563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
H00026119-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88450
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for COQ9 Antibody (NBP1-88450) (0)

There are no publications for COQ9 Antibody (NBP1-88450).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ9 Antibody (NBP1-88450) (0)

There are no reviews for COQ9 Antibody (NBP1-88450). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COQ9 Antibody (NBP1-88450) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ9 Products

Bioinformatics Tool for COQ9 Antibody (NBP1-88450)

Discover related pathways, diseases and genes to COQ9 Antibody (NBP1-88450). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ9 Antibody (NBP1-88450)

Discover more about diseases related to COQ9 Antibody (NBP1-88450).
 

Pathways for COQ9 Antibody (NBP1-88450)

View related products by pathway.

PTMs for COQ9 Antibody (NBP1-88450)

Learn more about PTMs related to COQ9 Antibody (NBP1-88450).

Blogs on COQ9

There are no specific blogs for COQ9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ9