ADP-ribosylarginine hydrolase Antibody (1F11)

Images

 
Western Blot: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Analysis of ADPRH expression in K-562 (Cat # L009V1).
Immunohistochemistry-Paraffin: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Analysis of monoclonal antibody to ADPRH on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
ELISA: ADP-ribosylarginine hydrolase Antibody (1F11) [H00000141-M04] - Detection limit for recombinant GST tagged ADPRH is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADP-ribosylarginine hydrolase Antibody (1F11) Summary

Immunogen
ADPRH (NP_001116.1, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIP
Specificity
Reacts with ADP-ribosylarginine hydrolase.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADPRH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Antibody reactivity against cell lysate for WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADP-ribosylarginine hydrolase Antibody (1F11)

  • [Protein ADP-ribosylarginine] hydrolase
  • ADP-ribosylarginine hydrolaseARH1ADP-ribose-L-arginine cleaving enzyme
  • EC 3.2.2.19

Background

The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes, which require DTT for maximal activity, the human enzyme is DTT-independent. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88835
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00026119-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-64347
Species: Bv, Ca, Ch, Eq, Ma, Gt, Gp, Hu, Pm, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6814
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-39073
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-86118
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF5129
Species: Hu
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-46320
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)

There are no publications for ADP-ribosylarginine hydrolase Antibody (H00000141-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)

There are no reviews for ADP-ribosylarginine hydrolase Antibody (H00000141-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADP-ribosylarginine hydrolase Products

Bioinformatics Tool for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)

Discover related pathways, diseases and genes to ADP-ribosylarginine hydrolase Antibody (H00000141-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)

Discover more about diseases related to ADP-ribosylarginine hydrolase Antibody (H00000141-M04).

PTMs for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)

Learn more about PTMs related to ADP-ribosylarginine hydrolase Antibody (H00000141-M04).

Blogs on ADP-ribosylarginine hydrolase

There are no specific blogs for ADP-ribosylarginine hydrolase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADP-ribosylarginine hydrolase Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADPRH
Entrez
Uniprot