ADP-ribosylarginine hydrolase Antibody (1F11) Summary
Immunogen |
ADPRH (NP_001116.1, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIP |
Specificity |
Reacts with ADP-ribosylarginine hydrolase. |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ADPRH |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Antibody reactivity against cell lysate for WB and recombinant protein in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ADP-ribosylarginine hydrolase Antibody (1F11)
Background
The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes, which require DTT for maximal activity, the human enzyme is DTT-independent. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Ca, Ch, Eq, Ma, Gt, Gp, Hu, Pm, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)
There are no publications for ADP-ribosylarginine hydrolase Antibody (H00000141-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)
There are no reviews for ADP-ribosylarginine hydrolase Antibody (H00000141-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADP-ribosylarginine hydrolase Antibody (H00000141-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADP-ribosylarginine hydrolase Products
Bioinformatics Tool for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)
Discover related pathways, diseases and genes to ADP-ribosylarginine hydrolase Antibody (H00000141-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)
Discover more about diseases related to ADP-ribosylarginine hydrolase Antibody (H00000141-M04).
|
PTMs for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)
Learn more about PTMs related to ADP-ribosylarginine hydrolase Antibody (H00000141-M04).
| | Research Areas for ADP-ribosylarginine hydrolase Antibody (H00000141-M04)
Find related products by research area.
|
Blogs on ADP-ribosylarginine hydrolase