COQ7 Antibody

Western Blot: COQ7 Antibody [NBP1-98496] - MDA-MB-435S Cell Lysate 1.0ug/ml, Gel Concentration: 12%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

COQ7 Antibody Summary

• Immunogen: The immunogen for this antibody is COQ7 - N-terminal region. Peptide sequence GQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COQ7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COQ7 Antibody

• CAT5
• CLK1
• CLK-1
• Coenzyme Q biosynthesis protein 7 homolog
• coenzyme Q, 7 (rat, yeast) homolog
• coenzyme Q7 homolog, ubiquinone (yeast)
• COQ7 coenzyme Q, 7 homolog ubiquinone
• placental protein KG-20
• Timing protein clk-1 homolog
• ubiquinone biosynthesis protein COQ7 homolog

Background

The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COQ7 Antibody (NBP1-98496)(1)

Publication using NBP1-98496

• SuArez-Rivero, J;Pastor-Maldonado, C;Romero-GonzAlez, A;GOmez-Fernandez, D;Povea-Cabello, S;Alvarez-COrdoba, M;VillalOn-GarcIa, I;TalaverOn-Rey, M;SuArez-Carrillo, A;Munuera-Cabeza, M;SAnchez-AlcAzar, J; Pterostilbene in Combination With Mitochondrial Cofactors Improve Mitochondrial Function in Cellular Models of Mitochondrial Diseases Frontiers in Pharmacology [PMID: 35370630]

Bioinformatics

• Gene Symbol: COQ7
• Uniprot:
  • NP_057222(Human)