COQ7 Antibody

Images

 
Western Blot: COQ7 Antibody [NBP1-98496] - MDA-MB-435S Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

COQ7 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen for this antibody is COQ7 - N-terminal region. Peptide sequence GQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-98496.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for COQ7 Antibody

  • CAT5
  • CLK1
  • CLK-1
  • Coenzyme Q biosynthesis protein 7 homolog
  • coenzyme Q, 7 (rat, yeast) homolog
  • coenzyme Q7 homolog, ubiquinone (yeast)
  • COQ7 coenzyme Q, 7 homolog ubiquinone
  • placental protein KG-20
  • Timing protein clk-1 homolog
  • ubiquinone biosynthesis protein COQ7 homolog

Background

The protein encoded by this gene is similar to a mitochondrial di-iron containing hydroxylase in Saccharomyces cerevisiae that is involved with ubiquinone biosynthesis. Mutations in the yeast gene lead to slower development and longer life span. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COQ7 Antibody (NBP1-98496)(1)

Reviews for COQ7 Antibody (NBP1-98496) (0)

There are no reviews for COQ7 Antibody (NBP1-98496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COQ7 Antibody (NBP1-98496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COQ7 Products

Research Areas for COQ7 Antibody (NBP1-98496)

Find related products by research area.

Blogs on COQ7

There are no specific blogs for COQ7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COQ7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ7
Uniprot