![Immunohistochemistry-Paraffin: COPS7A Antibody [NBP1-84369] - Staining of human pancreas shows distinct nuclear positivity in exocrine and islet cells.](http://images.novusbio.com/fullsize/COPS7A-Antibody-Immunohistochemistry-Paraffin-NBP1-84369-img0005.jpg "Immunohistochemistry-Paraffin: COPS7A Antibody [NBP1-84369] - Staining of human pancreas shows distinct nuclear positivity in exocrine and islet cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLD |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COPS7A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for COPS7A Antibody (NBP1-84369)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COPS7A |
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-immunocytochemistry-129202323510..jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")