COPS7A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COPS7A Antibody [NBP1-84369] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: COPS7A Antibody [NBP1-84369] - Staining of human pancreas shows distinct nuclear positivity in exocrine and islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COPS7A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPS7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COPS7A Protein (NBP1-84369PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COPS7A Antibody

  • COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 7A
  • COP9 complex subunit 7a
  • COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis)
  • COP9 signalosome complex subunit 7a
  • CSN7AMGC110877
  • Dermal papilla-derived protein 10
  • DERP10
  • JAB1-containing signalosome subunit 7a
  • SGN7a
  • Signalosome subunit 7a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56734
Species: Hu
Applications: ICC/IF
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91805
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC

Publications for COPS7A Antibody (NBP1-84369) (0)

There are no publications for COPS7A Antibody (NBP1-84369).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPS7A Antibody (NBP1-84369) (0)

There are no reviews for COPS7A Antibody (NBP1-84369). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COPS7A Antibody (NBP1-84369) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COPS7A Products

Bioinformatics Tool for COPS7A Antibody (NBP1-84369)

Discover related pathways, diseases and genes to COPS7A Antibody (NBP1-84369). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COPS7A Antibody (NBP1-84369)

Discover more about diseases related to COPS7A Antibody (NBP1-84369).
 

Pathways for COPS7A Antibody (NBP1-84369)

View related products by pathway.

PTMs for COPS7A Antibody (NBP1-84369)

Learn more about PTMs related to COPS7A Antibody (NBP1-84369).

Blogs on COPS7A

There are no specific blogs for COPS7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COPS7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPS7A