COP1 Antibody (5A0S9)

• Reactivity: Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 5A0S9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

COP1 Antibody (5A0S9) Summary

• Description: Novus Biologicals Rabbit COP1 Antibody (5A0S9) (NBP3-33503) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human COP1 (NP_071902.2).
  
  Sequence:
  YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: COP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for COP1 Antibody (5A0S9)

• Constitutive photomorphogenesis protein 1 homolog
• constitutive photomorphogenic protein (COP1)
• COP1RNF200FLJ10416
• E3 ubiquitin-protein ligase RFWD2
• EC 6.3.2.-
• hCOP1
• putative ubiquitin ligase COP1
• ring finger and WD repeat domain 2
• RING finger and WD repeat domain protein 2
• RING finger protein 200

Background

COP1 is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. It is directly involved in p53 ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. It ubiquitinates p53 independently of MDM2 or RCHY1. It probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, where the ubiquitin ligase activity is mediated by RBX1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COP1