Contactin-2/TAG1 Recombinant Protein Antigen

Images

 
There are currently no images for Contactin-2/TAG1 Protein (NBP1-90055PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Contactin-2/TAG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNTN2.

Source: E. coli

Amino Acid Sequence: PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CNTN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90055.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Contactin-2/TAG1 Recombinant Protein Antigen

  • Axonal glycoprotein TAG-1
  • axonin-1 cell adhesion molecule
  • Axonin-1
  • AXT
  • CNTN2
  • contactin 2 (axonal)
  • contactin 2 (transiently expressed)
  • Contactin2
  • Contactin-2
  • DKFZp781D102
  • FLJ37193
  • MGC157722
  • TAG1
  • TAG-1
  • TAX
  • TAX1
  • TAX-1
  • TAX1FLJ42746
  • Transient axonal glycoprotein 1
  • transiently-expressed axonal glycoprotein

Background

Contactin 2 is encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.; ; May play a role in the initial growth and guidance of axons. May be involved in cell adhesion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
AF5145
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
212-GD
Species: Hu
Applications: Bind, BA
AF2034
Species: Hu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
1310-SE
Species: Hu
Applications: EnzAct
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB

Publications for Contactin-2/TAG1 Protein (NBP1-90055PEP) (0)

There are no publications for Contactin-2/TAG1 Protein (NBP1-90055PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Contactin-2/TAG1 Protein (NBP1-90055PEP) (0)

There are no reviews for Contactin-2/TAG1 Protein (NBP1-90055PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Contactin-2/TAG1 Protein (NBP1-90055PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Contactin-2/TAG1 Products

Research Areas for Contactin-2/TAG1 Protein (NBP1-90055PEP)

Find related products by research area.

Blogs on Contactin-2/TAG1

There are no specific blogs for Contactin-2/TAG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Contactin-2/TAG1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTN2