Connexin 30/GJB6 Antibody - BSA Free

Western Blot: GJB6 Antibody [NBP1-59193] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Connexin 30/GJB6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GJB6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Connexin 30/GJB6 Antibody - BSA Free

• Connexin 30
• connexin-30
• CX30
• CX30gap junction protein, beta 6
• DFNA3B
• DFNB1B
• ectodermal dysplasia 2, hidrotic (Clouston syndrome)
• ED2
• EDH
• gap junction beta-6 protein
• gap junction protein, beta 6 (connexin 30)
• gap junction protein, beta 6, 30kDa
• GJB6
• HEDDFNA3

Background

Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extrac

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GJB6
• Uniprot:
  • O95452(Mouse)