Complement Factor I Antibody

Images

 
Immunohistochemistry-Paraffin: Complement Factor I Antibody [NBP1-88268] - Staining of human colon shows distinct positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Factor I Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CFI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Complement Factor I Recombinant Protein Antigen (NBP1-88268PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement Factor I Antibody

  • AHUS3
  • C3b Inactivator
  • C3B/C4B inactivator
  • C3BINA
  • C3b-inactivator
  • CFI
  • complement component I
  • complement control protein factor I
  • complement factor I heavy chain
  • Complement Factor I
  • EC 3.4.21
  • EC 3.4.21.45
  • FIC3b-INA
  • I factor (complement)
  • IF
  • KAF
  • Konglutinogen-activating factor
  • light chain of factor I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-83435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP1-88268
Species: Hu
Applications: IHC, IHC-P

Publications for Complement Factor I Antibody (NBP1-88268) (0)

There are no publications for Complement Factor I Antibody (NBP1-88268).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor I Antibody (NBP1-88268) (0)

There are no reviews for Complement Factor I Antibody (NBP1-88268). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Complement Factor I Antibody (NBP1-88268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Factor I Products

Bioinformatics Tool for Complement Factor I Antibody (NBP1-88268)

Discover related pathways, diseases and genes to Complement Factor I Antibody (NBP1-88268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Factor I Antibody (NBP1-88268)

Discover more about diseases related to Complement Factor I Antibody (NBP1-88268).
 

Pathways for Complement Factor I Antibody (NBP1-88268)

View related products by pathway.

PTMs for Complement Factor I Antibody (NBP1-88268)

Learn more about PTMs related to Complement Factor I Antibody (NBP1-88268).

Blogs on Complement Factor I

There are no specific blogs for Complement Factor I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Factor I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CFI
Entrez