Complement Factor H-related 4/CFHR4 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Complement Factor H-related 4/CFHR4 (NP_006675). Peptide sequence LWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CFHR4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Complement Factor H-related 4/CFHR4 Antibody - BSA Free
Background
CFHR4 is involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: WB
Publications for Complement Factor H-related 4/CFHR4 Antibody (NBP3-10545) (0)
There are no publications for Complement Factor H-related 4/CFHR4 Antibody (NBP3-10545).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Complement Factor H-related 4/CFHR4 Antibody (NBP3-10545) (0)
There are no reviews for Complement Factor H-related 4/CFHR4 Antibody (NBP3-10545).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Complement Factor H-related 4/CFHR4 Antibody (NBP3-10545) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Complement Factor H-related 4/CFHR4 Products
Blogs on Complement Factor H-related 4/CFHR4