Complement Factor H Recombinant Protein Antigen

Images

 
There are currently no images for Complement Factor H Protein (NBP2-33933PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Complement Factor H Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CFH.

Source: E. coli

Amino Acid Sequence: CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CFH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33933.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement Factor H Recombinant Protein Antigen

  • adrenomedullin binding protein
  • age-related maculopathy susceptibility 1
  • AHUS1
  • AMBP1
  • ARMD4
  • ARMS1
  • beta-1H
  • beta-1-H-globulin
  • beta-1-H-globulin
  • CFH
  • CFHL3
  • Complement Factor H
  • factor H
  • factor H-like 1
  • FH
  • FHL1
  • H factor 1 (complement)
  • H factor 1
  • H factor 2 (complement)
  • HF
  • HF1
  • HF1ARMS1
  • HF2
  • HUS
  • HUSMGC88246

Background

The complement Factor H protein is secreted into the bloodstream and acts in the regulation of complement activation. Mutations leading to changes in this protein have been linked with HUS (hemolytic-uremic syndrome) and chronic hypocomplementemic nephropathy. Factor H is mainly synthesised in the liver but also in macrophages and endothelium. It is primarily aplasma glycoprotein but is also found in platelets and there is a membrane bound form on some leukocytes. Consisting of a single polypeptide, the major form of Factor H has a molecular weight of 155kDa. There are two truncated forms, a non-glycosylated 49 kDa form and a glycosylated 39-43 kDaform. Plasma concentrations are in the range 200-600mg/L for the 155 kDa form and 1-5mg/L for thetruncated forms. Factor H is a major regulatory protein of the complement system. By binding to C3b it either displacesor prevents the binding of Bb (activated Factor B). When bound to Factor H, C3b is susceptible tocleavage by Factor 1 to yield iC3b. Factor H is released or modified following this cleavage. The regulatory role of Factor H is essential because C3bBb is not only a C5 convertase but a C3 convertaseand so has a positive feedback effect, potentially consuming the entire C3 pool if unregulated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC,  IHC-P, S-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF2009
Species: Hu
Applications: ICC, IHC
MAB3307
Species: Hu
Applications: IP, WB
DY1707
Species: Hu
Applications: ELISA
AF1936
Species: Hu
Applications: IP, WB
M6000B
Species: Mu
Applications: ELISA
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-14474
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DADT130
Species: Hu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
NBP1-07010
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for Complement Factor H Protein (NBP2-33933PEP) (0)

There are no publications for Complement Factor H Protein (NBP2-33933PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Factor H Protein (NBP2-33933PEP) (0)

There are no reviews for Complement Factor H Protein (NBP2-33933PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement Factor H Protein (NBP2-33933PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement Factor H Products

Blogs on Complement Factor H

There are no specific blogs for Complement Factor H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement Factor H Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CFH