Complement Component C5aR1 Recombinant Protein Antigen

Images

 
There are currently no images for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Complement Component C5aR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Complement Component C5aR1

Source: E.coli

Amino Acid Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C5AR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21274. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Complement Component C5aR1 Recombinant Protein Antigen

  • C5a anaphylatoxin chemotactic receptor
  • C5A
  • C5aR
  • C5a-R
  • C5AR1
  • C5ARC5a anaphylatoxin receptor
  • C5R1C5a ligand
  • CD88 antigen
  • CD88
  • complement component 5 receptor 1 (C5a ligand)
  • complement component 5 receptor 1
  • complement component 5a receptor 1
  • Complement Component C5a R1
  • Complement Component C5aR1

Background

The human anaphylatoxin C5a is a 74 residue glycopeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. A variety of biological effects evoked by C5a can be demonstrated, rendering this molecule an important mediartor of inflammation, with granulocytes and macrophages as the main target cells. All cellular responses to C5a are specifically mediated by interactions with the membrane bound C5a receptor, a seven transmembrane GTP binding coupled receptor that belongs to the rhodopsin supergene family. C5a receptor 1 expression has been reported in myeloid blood cells, brain, liver, lung, spleen, heart, kidney, and intestinal tract. ESTs have been isolated from B cell/lung/testis, nerve, and placenta libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

2150-C5
Species: Mu
Applications: BA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
M6000B
Species: Mu
Applications: ELISA
MAB3744
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP2-15649
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF3844
Species: Hu, Mu
Applications: IHC
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
201-LB
Species: Hu
Applications: BA
NBP3-21274PEP
Species: Hu
Applications: AC

Publications for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP) (0)

There are no publications for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP) (0)

There are no reviews for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement Component C5aR1 Products

Research Areas for Complement Component C5aR1 Recombinant Protein Antigen (NBP3-21274PEP)

Find related products by research area.

Blogs on Complement Component C5aR1

There are no specific blogs for Complement Component C5aR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Complement Component C5aR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C5AR1