Novus Biologicals products are now on bio-techne.com

Recombinant Human Complement Component C1qC GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Complement Component C1qC Protein [H00000714-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Complement Component C1qC GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-245 of Human C1QC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
C1QC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
52.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Complement Component C1qC GST (N-Term) Protein

  • C1qC
  • C1Q-C
  • C1QGcomplement component 1, q subcomponent, gamma polypeptide
  • complement C1q subcomponent subunit C
  • complement component 1, q subcomponent, C chain
  • Complement Component C1qC
  • FLJ27103

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51139
Species: Hu, Mu, Rt
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, WB
NBP2-79788
Species: Hu
Applications: IHC, IHC-P, PA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2558
Species: Hu, Mu
Applications: Simple Western, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
1090-TW/CF
Species: Hu
Applications: BA
375-TL
Species: Hu
Applications: BA
DRT100
Species: Hu
Applications: ELISA
DY805
Species: Hu
Applications: ELISA
DBLYS0B
Species: Hu
Applications: ELISA
MAB10541
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
7268-CT
Species: Hu
Applications: BA
AF3388
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
DCDL40
Species: Hu
Applications: ELISA
NBP2-52575
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00000714-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Complement Component C1qC Recombinant Protein (H00000714-P01) (0)

There are no publications for Complement Component C1qC Recombinant Protein (H00000714-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C1qC Recombinant Protein (H00000714-P01) (0)

There are no reviews for Complement Component C1qC Recombinant Protein (H00000714-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Component C1qC Recombinant Protein (H00000714-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Complement Component C1qC Products

Blogs on Complement Component C1qC

There are no specific blogs for Complement Component C1qC, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Complement Component C1qC GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QC