Recombinant Human Complement C5 Protein

Images

 
SDS-Page: Recombinant Human Complement C5 Protein [H00000727-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Complement C5 Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-112 of Human C5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
C5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Complement C5 Protein

  • anaphylatoxin C5a analog
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4
  • C5
  • complement C5
  • complement component 5
  • CPAMD4MGC142298
  • FLJ17816
  • FLJ17822

Background

C5 - complement component 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91803
Species: Hu
Applications: WB, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB3648
Species: Hu
Applications: Flow, CyTOF-ready, Neut
MAB1936
Species: Hu
Applications: WB, IP
NBP2-80406
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15952
Species: Hu, Mu
Applications: WB, ICC/IF
MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-74621
Species: Hu
Applications: WB (-), IP
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-87492
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Complement C5 Partial Recombinant Protein (H00000727-Q01) (0)

There are no publications for Complement C5 Partial Recombinant Protein (H00000727-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C5 Partial Recombinant Protein (H00000727-Q01) (0)

There are no reviews for Complement C5 Partial Recombinant Protein (H00000727-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement C5 Partial Recombinant Protein (H00000727-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for a recombinant mouse C5 as standard for a mouse C5 ELISA. Is your product # H00000727-Q01 good for this?
    • This product is produced by a Taiwanese company called Abnova and we distribute it for them. We do no in-house testing or development of their products. H00000727-Q01 is a partial recombinant protein, so you will want to make sure your antibody will recognize the portion of C5 present in this protein before using it as a control.

Other Available Formats

Additional Complement C5 Products

Bioinformatics Tool for Complement C5 Partial Recombinant Protein (H00000727-Q01)

Discover related pathways, diseases and genes to Complement C5 Partial Recombinant Protein (H00000727-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C5 Partial Recombinant Protein (H00000727-Q01)

Discover more about diseases related to Complement C5 Partial Recombinant Protein (H00000727-Q01).
 

Pathways for Complement C5 Partial Recombinant Protein (H00000727-Q01)

View related products by pathway.

PTMs for Complement C5 Partial Recombinant Protein (H00000727-Q01)

Learn more about PTMs related to Complement C5 Partial Recombinant Protein (H00000727-Q01).
 

Research Areas for Complement C5 Partial Recombinant Protein (H00000727-Q01)

Find related products by research area.

Blogs on Complement C5.

Complement C3 - the most important protein in the complement system
The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau...  Read full blog post.

Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Complement C5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C5
COVID-19 update