Recombinant Human Collagen VI alpha 1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Collagen VI Protein [H00001291-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Collagen VI alpha 1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 919-1028 of Human Collagen VI

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGESHLFRVPSYQALLRGVFHQTVSRKVALG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
COL6A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Collagen VI alpha 1 GST (N-Term) Protein

  • Collagen 6
  • collagen alpha-1(VI) chain
  • collagen VI, alpha-1 polypeptide
  • collagen, type VI, alpha 1
  • Collagen-6
  • human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA)
  • OPLL

Background

COL6A1 - collagen, type VI, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001292-M01
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-97126
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF1936
Species: Hu
Applications: IP, WB
DY2037
Species: Hu
Applications: ELISA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
DIP100
Species: Hu
Applications: ELISA
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-80406
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB600-408
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PAGE, WB
7954-GM/CF
Species: Hu
Applications: BA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB600-594
Species: Bv, Fe, Hu, Mu, Rt, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-76289
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01) (0)

There are no publications for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01) (0)

There are no reviews for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Collagen VI alpha 1 Products

Bioinformatics Tool for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01)

Discover related pathways, diseases and genes to Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01)

Discover more about diseases related to Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01).
 

Pathways for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01)

View related products by pathway.

PTMs for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01)

Learn more about PTMs related to Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01).
 

Research Areas for Collagen VI alpha 1 Partial Recombinant Protein (H00001291-Q01)

Find related products by research area.

Blogs on Collagen VI alpha 1

There are no specific blogs for Collagen VI alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Collagen I Antibody
NB600-408-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Collagen VI alpha 1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COL6A1