Collagen II Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Collagen II Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55511PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Collagen II Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Collagen II.

Source: E.coli

Amino Acid Sequence: PGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATL

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL2A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55511 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Collagen II Recombinant Protein Antigen

  • Alpha-1 type II collagen
  • ANFH
  • AOM
  • cartilage collagen
  • Chondrocalcin
  • COL11A3
  • COL2A1
  • Collagen 2
  • collagen alpha-1(II) chain
  • Collagen II
  • collagen II, alpha-1 polypeptide
  • collagen type 2
  • collagen, type II, alpha 1 (primary osteoarthritis, spondyloepiphysealdysplasia, congenital)
  • collagen, type II, alpha 1
  • Collagen-2
  • MGC131516
  • SEDC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90271
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67068
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Ba, Bv, Fe, Rb
Applications: WB, ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP2-55511PEP
Species: Hu
Applications: AC

Publications for Collagen II Recombinant Protein Antigen (NBP2-55511PEP) (0)

There are no publications for Collagen II Recombinant Protein Antigen (NBP2-55511PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen II Recombinant Protein Antigen (NBP2-55511PEP) (0)

There are no reviews for Collagen II Recombinant Protein Antigen (NBP2-55511PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Collagen II Recombinant Protein Antigen (NBP2-55511PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Collagen II Products

Bioinformatics Tool for Collagen II Recombinant Protein Antigen (NBP2-55511PEP)

Discover related pathways, diseases and genes to Collagen II Recombinant Protein Antigen (NBP2-55511PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen II Recombinant Protein Antigen (NBP2-55511PEP)

Discover more about diseases related to Collagen II Recombinant Protein Antigen (NBP2-55511PEP).
 

Pathways for Collagen II Recombinant Protein Antigen (NBP2-55511PEP)

View related products by pathway.

PTMs for Collagen II Recombinant Protein Antigen (NBP2-55511PEP)

Learn more about PTMs related to Collagen II Recombinant Protein Antigen (NBP2-55511PEP).
 

Research Areas for Collagen II Recombinant Protein Antigen (NBP2-55511PEP)

Find related products by research area.

Blogs on Collagen II

There are no specific blogs for Collagen II, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Collagen II Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL2A1