COL4A6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COL4A6 Antibody [NBP2-56903] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COL4A6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
Specificity
Specificity of human COL4A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL4A6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
COL4A6 Knockout HeLa Cell Lysate
Control Peptide
COL4A6 Recombinant Protein Antigen (NBP2-56903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COL4A6 Antibody

  • collagen alpha 6 type IV
  • collagen alpha-6(IV) chain
  • collagen IV, alpha-6 polypeptide
  • collagen of basement membrane, alpha-6
  • collagen, type IV, alpha 6
  • CXDELq22.3
  • DELXq22.3
  • dJ889N15.4 (Collagen Alpha 6(IV))
  • EC 2.7.7.8
  • MGC88184

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03487
Species: Rt
Applications: IHC
MAB7546
Species: Hu
Applications: WB
NBP2-92506
Species: Hu, Mu, Rt
Applications: WB
AF745
Species: Mu
Applications: WB, Block
NBP1-26549
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Ba, Bv, Fe, Rb
Applications: WB, ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76937
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00002316-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-56903
Species: Hu
Applications: ICC/IF

Publications for COL4A6 Antibody (NBP2-56903) (0)

There are no publications for COL4A6 Antibody (NBP2-56903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL4A6 Antibody (NBP2-56903) (0)

There are no reviews for COL4A6 Antibody (NBP2-56903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COL4A6 Antibody (NBP2-56903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COL4A6 Products

Bioinformatics Tool for COL4A6 Antibody (NBP2-56903)

Discover related pathways, diseases and genes to COL4A6 Antibody (NBP2-56903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL4A6 Antibody (NBP2-56903)

Discover more about diseases related to COL4A6 Antibody (NBP2-56903).
 

Pathways for COL4A6 Antibody (NBP2-56903)

View related products by pathway.

PTMs for COL4A6 Antibody (NBP2-56903)

Learn more about PTMs related to COL4A6 Antibody (NBP2-56903).

Blogs on COL4A6

There are no specific blogs for COL4A6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL4A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL4A6