![Western Blot: COL27A1 Antibody [NBP2-84711] - Host: Rabbit. Target Name: COL27A1. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/COL27A1-Antibody-Western-Blot-NBP2-84711-img0001.jpg "Western Blot: COL27A1 Antibody [NBP2-84711] - Host: Rabbit. Target Name: COL27A1. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit COL27A1 Antibody - BSA Free (NBP2-84711) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human COL27A1. Peptide sequence: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COL27A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry Matrilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3044_human-matrilin-2-affinity-purified-polyclonal-ab-immunocytochemistry-2112020132950.jpg)
![Immunohistochemistry Matrilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af3044_human-matrilin-2-affinity-purified-polyclonal-ab-4120241239496.jpg)
![Immunohistochemistry Matrilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af3044_human-matrilin-2-affinity-purified-polyclonal-ab-4120241240355.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COL27A1 |
![Western Blot: COL27A1 Antibody [NBP2-84711] - Host: Rabbit. Target: COL27A1. Positive control (+): Human Stomach (ST). Negative control (-): Human Small Intestine (IN). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/COL27A1-Antibody-Western-Blot-NBP2-84711-img0002.jpg "Western Blot: COL27A1 Antibody [NBP2-84711] - Host: Rabbit. Target: COL27A1. Positive control (+): Human Stomach (ST). Negative control (-): Human Small Intestine (IN). Antibody concentration: 1ug/ml")
![Western Blot CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD39L1_AF5797_Western_Blot_9441.jpg)
![Immunocytochemistry/ Immunofluorescence CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images/af5797_mouse-rat-cd39l1-entpd2-affinity-purified-polyclonal-ab-41202412394941.jpg)
![Immunocytochemistry/ Immunofluorescence CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images/af5797_mouse-rat-cd39l1-entpd2-affinity-purified-polyclonal-ab-41202412401213.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Simple Western SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Simple_Western_22563.jpg)
![Western Blot Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Western_Blot_5347.jpg)
![Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Chromatin_Immunoprecipitation_11240.jpg)
![Immunocytochemistry Smad2/3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad3_AF3797_Immunocytochemistry_11829.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
