COL24A1 Antibody (1D8) - Azide and BSA Free

Western Blot: COL24A1 Antibody (1D8) [H00255631-M07] - Detection against Immunogen (35.53 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COL24A1 Antibody (1D8) - Azide and BSA Free Summary

• Immunogen: COL24A1 (NP_690850, 1626 a.a. ~ 1714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
• Specificity: COL24A1 (1D8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: COL24A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COL24A1 Antibody (1D8) - Azide and BSA Free

• collagen alpha-1(XXIV) chain
• collagen, type XXIV, alpha 1
• MGC142214

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL24A1
• Entrez:
  • 255631(Human)
• Uniprot:
  • NP_690850(Human)