COL16A1 Antibody - Azide and BSA Free

Western Blot: COL16A1 Antibody [NBP3-15605] - Western blot analysis of extracts of PC-3 cells, using COL16A1 antibody (NBP3-15605) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: COL16A1 Antibody [NBP3-15605] - Western blot analysis of extracts of various cell lines, using COL16A1 antibody (NBP3-15605) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

COL16A1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3). PRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COL16A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 50% glycerol, pH7.3
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for COL16A1 Antibody - Azide and BSA Free

• alpha 1 type XVI collagen
• collagen alpha-1(XVI) chain
• collagen XVI, alpha-1 polypeptide
• collagen, type XVI, alpha 1,447AA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COL16A1