COG7 Antibody

Images

 
Western Blot: COG7 Antibody [NBP2-56614] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: COG7 Antibody [NBP2-56614] - Staining of human cell line MCF7 shows localization to the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COG7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVN
Specificity
Specificity of human COG7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COG7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COG7 Recombinant Protein Antigen (NBP2-56614PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for COG7 Antibody

  • CDG2E
  • component of oligomeric golgi complex 7COG complex subunit 7
  • conserved oligomeric Golgi complex subunit 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57681
Species: Hu
Applications: WB, ICC/IF
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-93714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45631
Species: Hu, Mk
Applications: WB, IHC, IF
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for COG7 Antibody (NBP2-56614) (0)

There are no publications for COG7 Antibody (NBP2-56614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG7 Antibody (NBP2-56614) (0)

There are no reviews for COG7 Antibody (NBP2-56614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COG7 Antibody (NBP2-56614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for COG7 Antibody (NBP2-56614)

Discover related pathways, diseases and genes to COG7 Antibody (NBP2-56614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG7 Antibody (NBP2-56614)

Discover more about diseases related to COG7 Antibody (NBP2-56614).
 

Pathways for COG7 Antibody (NBP2-56614)

View related products by pathway.

PTMs for COG7 Antibody (NBP2-56614)

Learn more about PTMs related to COG7 Antibody (NBP2-56614).

Blogs on COG7

There are no specific blogs for COG7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COG7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COG7