COG4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: COG4 Antibody [NBP2-30718] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry: COG4 Antibody [NBP2-30718] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COG4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ILDLKFCMDGVQTALRSEDYEQAAAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COG4 Protein (NBP2-30718PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COG4 Antibody

  • CDG2J
  • COD1complexed with Dor1p
  • COG complex subunit 4
  • component of oligomeric golgi complex 4DKFZp586E1519
  • conserved oligomeric Golgi complex protein 4
  • conserved oligomeric Golgi complex subunit 4
  • DKFZP586E1519

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58437
Species: Hu
Applications: WB, ICC/IF
NBP1-81414
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57681
Species: Hu
Applications: WB, ICC/IF
NBP2-45631
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-47502
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56441
Species: Hu, Mu, Rt
Applications: WB
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56318
Species: Hu
Applications: ICC/IF
NBP1-80698
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-19621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027032-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-30718
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for COG4 Antibody (NBP2-30718) (0)

There are no publications for COG4 Antibody (NBP2-30718).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG4 Antibody (NBP2-30718) (0)

There are no reviews for COG4 Antibody (NBP2-30718). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COG4 Antibody (NBP2-30718) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COG4 Products

Bioinformatics Tool for COG4 Antibody (NBP2-30718)

Discover related pathways, diseases and genes to COG4 Antibody (NBP2-30718). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COG4 Antibody (NBP2-30718)

Discover more about diseases related to COG4 Antibody (NBP2-30718).
 

Pathways for COG4 Antibody (NBP2-30718)

View related products by pathway.

PTMs for COG4 Antibody (NBP2-30718)

Learn more about PTMs related to COG4 Antibody (NBP2-30718).
 

Research Areas for COG4 Antibody (NBP2-30718)

Find related products by research area.

Blogs on COG4

There are no specific blogs for COG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COG4
Uniprot