COA5 Antibody

Images

 
Western Blot: COA5 Antibody [NBP2-31690] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2
Immunocytochemistry/ Immunofluorescence: COA5 Antibody [NBP2-31690] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: COA5 Antibody [NBP2-31690] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COA5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COA5 Protein (NBP2-31690PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COA5 Antibody

  • chromosome 2 open reading frame 64
  • FLJ27524,6330578E17Rik
  • hypothetical protein LOC493753
  • MGC52110

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00084701-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-31863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39115
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82769
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14477
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
H00003346-T01
Species: Hu
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14613
Species: Hu
Applications: WB, IHC, IHC-P

Publications for COA5 Antibody (NBP2-31690) (0)

There are no publications for COA5 Antibody (NBP2-31690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COA5 Antibody (NBP2-31690) (0)

There are no reviews for COA5 Antibody (NBP2-31690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COA5 Antibody (NBP2-31690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COA5 Products

Bioinformatics Tool for COA5 Antibody (NBP2-31690)

Discover related pathways, diseases and genes to COA5 Antibody (NBP2-31690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on COA5

There are no specific blogs for COA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COA5
Uniprot