COA5 Antibody


Western Blot: COA5 Antibody [NBP2-31690] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2
Immunocytochemistry/ Immunofluorescence: COA5 Antibody [NBP2-31690] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: COA5 Antibody [NBP2-31690] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC

Order Details

COA5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COA5 Protein (NBP2-31690PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for COA5 Antibody

  • chromosome 2 open reading frame 64
  • FLJ27524,6330578E17Rik
  • hypothetical protein LOC493753
  • MGC52110


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COA5 Antibody (NBP2-31690) (0)

There are no publications for COA5 Antibody (NBP2-31690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COA5 Antibody (NBP2-31690) (0)

There are no reviews for COA5 Antibody (NBP2-31690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for COA5 Antibody (NBP2-31690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COA5 Antibody and receive a gift card or discount.


Gene Symbol COA5