CNPase Antibody


Western Blot: CNPase Antibody [NBP1-85999] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining in human cerebral cortex and pancreas tissues using anti-CNP antibody. Corresponding CNP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CNPase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG
Oligodendrocyte Marker
Specificity of human CNPase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
CNPase Lysate (NBP2-64872)
Control Peptide
CNPase Protein (NBP1-85999PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CNPase Antibody

  • 2', 3' cyclic nucleotide 3' phosphohydrolase
  • 2'-3'-cyclic nucleotide 3' phosphodiesterase
  • 2'-3'-cyclic-nucleotide 3'-phosphodiesterase
  • CNP1
  • CNPase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB

Publications for CNPase Antibody (NBP1-85999) (0)

There are no publications for CNPase Antibody (NBP1-85999).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNPase Antibody (NBP1-85999) (0)

There are no reviews for CNPase Antibody (NBP1-85999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNPase Antibody (NBP1-85999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional CNPase Products

Bioinformatics Tool for CNPase Antibody (NBP1-85999)

Discover related pathways, diseases and genes to CNPase Antibody (NBP1-85999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNPase Antibody (NBP1-85999)

Discover more about diseases related to CNPase Antibody (NBP1-85999).

Pathways for CNPase Antibody (NBP1-85999)

View related products by pathway.

PTMs for CNPase Antibody (NBP1-85999)

Learn more about PTMs related to CNPase Antibody (NBP1-85999).

Research Areas for CNPase Antibody (NBP1-85999)

Find related products by research area.

Blogs on CNPase

There are no specific blogs for CNPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNPase Antibody and receive a gift card or discount.


Gene Symbol CNP