CNPase Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CNPase Antibody [NBP1-85999] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is show in green.

Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining in human cerebral cortex and pancreas tissues using NBP1-85999 antibody. Corresponding CNP RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human cerebral cortex shows strong positivity in neuronal processes.

Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human duodenum shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CNPase Antibody [NBP1-85999] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Analysis in human cerebral cortex tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CNPase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CNPase Antibody - BSA Free (NBP1-85999) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CNPase Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVTYFG
• Marker: Oligodendrocyte Marker
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  CNPase Protein (NBP1-85999PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CNPase Antibody - BSA Free

• 2', 3' cyclic nucleotide 3' phosphohydrolase
• 2'-3'-cyclic nucleotide 3' phosphodiesterase
• 2'-3'-cyclic-nucleotide 3'-phosphodiesterase
• CNP1
• CNPase
• EC 3.1.4.37

Background

2,3-cyclic nucleotide-3-phosphodiesterase (CNP) is a membrane bound, microtubule associated protein that is among the most abundant myelin proteins of the CNS. It is thought that CNP may serve as a regulator of tubulin polymerization and of microtubule distribution (Bifulco et al., 2002). It was recently found that CNP may also function as a possible linker protein anchoring microtubules to the plasma membrane via a 13 residue C-terminal CNP fragment (Bifulco et al., 2002, Esposito et al., 2008).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CNPase Antibody (NBP1-85999)(1)

Publication using NBP1-85999

• Mellai M, Annovazzi L, Bisogno I et al. Chondroitin Sulphate Proteoglycan 4 (NG2/CSPG4) Localization in Low- and High-Grade Gliomas Cells 2020-06-24 [PMID: 32599896]

Bioinformatics

• Gene Symbol: CNP