CNOT4 Antibody

Images

 
Western Blot: CNOT4 Antibody [NBP1-84439] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CNOT4 Antibody [NBP1-84439] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
Western Blot: CNOT4 Antibody [NBP1-84439] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNOT4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNOT4 Protein (NBP1-84439PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNOT4 Antibody

  • CCR4-associated factor 4
  • CCR4-NOT transcription complex, subunit 4
  • E3 ubiquitin-protein ligase CNOT4
  • EC 6.3.2.-
  • NOT4yeast) homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46323
Species: Hu
Applications: WB, IHC
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP2-46270
Species: Hu
Applications: WB, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB

Publications for CNOT4 Antibody (NBP1-84439) (0)

There are no publications for CNOT4 Antibody (NBP1-84439).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT4 Antibody (NBP1-84439) (0)

There are no reviews for CNOT4 Antibody (NBP1-84439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNOT4 Antibody (NBP1-84439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT4 Products

Bioinformatics Tool for CNOT4 Antibody (NBP1-84439)

Discover related pathways, diseases and genes to CNOT4 Antibody (NBP1-84439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CNOT4 Antibody (NBP1-84439)

View related products by pathway.

PTMs for CNOT4 Antibody (NBP1-84439)

Learn more about PTMs related to CNOT4 Antibody (NBP1-84439).

Blogs on CNOT4

There are no specific blogs for CNOT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT4