CNOT1 Antibody

Images

 
Immunohistochemistry: CNOT1 Antibody [NBP2-32045] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNOT1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT1 Protein (NBP2-32045PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNOT1 Antibody

  • AD-005
  • adrenal gland protein AD-005
  • CCR4-associated factor 1
  • CCR4-NOT transcription complex subunit 1
  • CCR4-NOT transcription complex, subunit 1
  • CDC39DKFZp686E0722
  • hNOT1
  • KIAA1007DKFZp686O168
  • Negative regulator of transcription subunit 1 homolog
  • NOT1 (negative regulator of transcription 1, yeast) homolog
  • NOT1FLJ90644
  • NOT1HFLJ36492

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-46323
Species: Hu
Applications: WB, IHC
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP2-24527
Species: Hu, Mu, Rt, Bv, Ch, Xp
Applications: WB, IHC-P
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
AF5228
Species: Hu
Applications: WB
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46586
Species: Hu
Applications: IHC
NBP1-28751
Species: Hu, Mu
Applications: WB, IB, IP
H00011140-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNOT1 Antibody (NBP2-32045) (0)

There are no publications for CNOT1 Antibody (NBP2-32045).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT1 Antibody (NBP2-32045) (0)

There are no reviews for CNOT1 Antibody (NBP2-32045). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNOT1 Antibody (NBP2-32045) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT1 Products

Bioinformatics Tool for CNOT1 Antibody (NBP2-32045)

Discover related pathways, diseases and genes to CNOT1 Antibody (NBP2-32045). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT1 Antibody (NBP2-32045)

Discover more about diseases related to CNOT1 Antibody (NBP2-32045).
 

Pathways for CNOT1 Antibody (NBP2-32045)

View related products by pathway.

PTMs for CNOT1 Antibody (NBP2-32045)

Learn more about PTMs related to CNOT1 Antibody (NBP2-32045).

Blogs on CNOT1

There are no specific blogs for CNOT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT1
Uniprot