CLTB Antibody

Images

 
Western Blot: CLTB Antibody [NBP1-68945] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLTB Antibody Summary

Immunogen
Synthetic peptides corresponding to CLTB (clathrin, light chain (Lcb)) The peptide sequence was selected from the C terminal of CLTB. Peptide sequence ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLTB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CLTB and was validated on Western blot.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLTB Antibody

  • clathrin light chain B
  • clathrin, light chain (Lcb)
  • clathrin, light chain B
  • clathrin, light polypeptide (Lcb)
  • Lcb

Background

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-613
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IM, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-68945
Species: Hu
Applications: WB

Publications for CLTB Antibody (NBP1-68945) (0)

There are no publications for CLTB Antibody (NBP1-68945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLTB Antibody (NBP1-68945) (0)

There are no reviews for CLTB Antibody (NBP1-68945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLTB Antibody (NBP1-68945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLTB Products

Bioinformatics Tool for CLTB Antibody (NBP1-68945)

Discover related pathways, diseases and genes to CLTB Antibody (NBP1-68945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLTB Antibody (NBP1-68945)

Discover more about diseases related to CLTB Antibody (NBP1-68945).
 

Pathways for CLTB Antibody (NBP1-68945)

View related products by pathway.

PTMs for CLTB Antibody (NBP1-68945)

Learn more about PTMs related to CLTB Antibody (NBP1-68945).
 

Research Areas for CLTB Antibody (NBP1-68945)

Find related products by research area.

Blogs on CLTB

There are no specific blogs for CLTB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLTB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLTB
Uniprot