Reactivity | Hu, MuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | CLTB (NP_001825.1, 1 a.a. - 211 a.a.) full-length human protein. MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR |
Specificity | CLTB - clathrin, light chain (Lcb), |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CLTB |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CLTB Antibody (H00001212-D01P)Discover more about diseases related to CLTB Antibody (H00001212-D01P).
| Pathways for CLTB Antibody (H00001212-D01P)View related products by pathway.
|
PTMs for CLTB Antibody (H00001212-D01P)Learn more about PTMs related to CLTB Antibody (H00001212-D01P).
| Research Areas for CLTB Antibody (H00001212-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CLTB |
Entrez |
|
Uniprot |
|