CLTB Antibody - Azide and BSA Free

Western Blot: CLTB Antibody [H00001212-D01P] - Analysis of CLTB expression in mouse spleen.

Western Blot: CLTB Antibody [H00001212-D01P] - Analysis of CLTB expression in human stomach.

Western Blot: CLTB Antibody [H00001212-D01P] - Analysis of CLTB expression in transfected 293T cell line by CLTB rabbit polyclonal antibody.Lane 1: CLTB transfected lysate(23.20 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CLTB Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CLTB (NP_001825.1, 1 a.a. - 211 a.a.) full-length human protein. MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• Specificity: CLTB - clathrin, light chain (Lcb),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLTB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLTB Antibody - Azide and BSA Free

• clathrin light chain B
• clathrin, light chain (Lcb)
• clathrin, light chain B
• clathrin, light polypeptide (Lcb)
• Lcb

Background

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLTB
• Entrez:
  • 1212(Human)
• Uniprot:
  • NP_001825.1(Human)