CLIC3 Antibody - BSA Free

Western Blot: CLIC3 Antibody [NBP1-89465] - Analysis in human cell lines MCF-7 and A-549 using anti-CLIC3 antibody. Corresponding CLIC3 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: CLIC3 Antibody [NBP1-89465] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies. Antibody staining is shown in green.

Simple Western: CLIC3 Antibody [NBP1-89465] - Simple Western lane view shows a specific band for CLIC3 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: CLIC3 Antibody [NBP1-89465] - Electropherogram image of the corresponding Simple Western lane view. CLIC3 antibody was used at 1:20 dilution on MCF-7 lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLIC3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQ
• Predicted Species: Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLIC3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in MCF-7 lysate(s), separated by Size, antibody dilution of 1:20, apparent MW was 33 kDa.
• Control Peptide:

  CLIC3 Protein (NBP1-89465PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLIC3 Antibody - BSA Free

• chloride intracellular channel 3
• chloride intracellular channel protein 3

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLIC3