We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CLEC4E Recombinant Protein Antigen

Images

 
There are currently no images for CLEC4E Protein (NBP2-13844PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLEC4E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLEC4E.

Source: E. coli

Amino Acid Sequence: SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLEC4E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13844.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLEC4E Recombinant Protein Antigen

  • CLEC4E
  • CLECSF9
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 9
  • C-type lectin domain family 4 member E
  • C-type lectin domain family 4, member E
  • Macrophage-inducible C-type lectin
  • MINCLE
  • MINCLEC-type lectin superfamily member 9

Background

CLEC4E encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
MAB1859
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC
NBP2-27159
Species: Hu, Pm
Applications: CyTOF-ready, Flow-CS, Flow, IHC,  IHC-P, WB
DDX0180P-100
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr,  IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-25463
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
5468-ST
Species: Hu
Applications: BA
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
H00010875-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, IP, WB
AF2950
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF5085
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-32982
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00001406-M02
Species: Bv, Fi, Hu, Mu
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for CLEC4E Protein (NBP2-13844PEP) (0)

There are no publications for CLEC4E Protein (NBP2-13844PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC4E Protein (NBP2-13844PEP) (0)

There are no reviews for CLEC4E Protein (NBP2-13844PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLEC4E Protein (NBP2-13844PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLEC4E Products

Research Areas for CLEC4E Protein (NBP2-13844PEP)

Find related products by research area.

Blogs on CLEC4E.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLEC4E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC4E