![Western Blot: CLEC14A Antibody [NBP2-30854] - Analysis in control (vector only transfected HEK293T lysate) and CLEC14A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Western-Blot-NBP2-30854-img0006.jpg "Western Blot: CLEC14A Antibody [NBP2-30854] - Analysis in control (vector only transfected HEK293T lysate) and CLEC14A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLEC14A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Galanin R2/GALR2 Antibody (616520) [Unconjugated]](https://images.novusbio.com/images2/Galanin_R2_MAB6544_Immunohistochemistry_10364.jpg)
![Flow Cytometry Galanin R2/GALR2 Antibody (616520) [Unconjugated]](https://images.novusbio.com/images2/Galanin_R2_MAB6544_Flow_Cytometry_23555.jpg)
| Publication using NBP2-30854 | Applications | Species |
|---|---|---|
| Galvagni F, Nardi F, Spiga O et al. Dissecting the CD93-Multimerin 2 interaction involved in cell adhesion and migration of the activated endothelium Matrix Biol. 2017-09-11 [PMID: 28912033] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CLEC14A Antibody [NBP2-30854] - Staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30854-img0005.jpg "Immunocytochemistry/Immunofluorescence: CLEC14A Antibody [NBP2-30854] - Staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum & the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human liver shows low positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0011.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human liver shows low positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human lung shows strong membranous positivity in respitory epithelial cells.](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0008.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human lung shows strong membranous positivity in respitory epithelial cells.")
![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human placenta shows moderate to strong membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0009.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human placenta shows moderate to strong membranous positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human cerebral cortex shows strong membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/CLEC14A-Antibody-Immunohistochemistry-Paraffin-NBP2-30854-img0010.jpg "Immunohistochemistry-Paraffin: CLEC14A Antibody [NBP2-30854] - Staining of human cerebral cortex shows strong membranous positivity in endothelial cells.")
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images2/UNC5H2_AF1006_Western_Blot_17311.jpg)
![Immunohistochemistry UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images2/af1006_rat-unc5h2-unc5b-affinity-purified-polyclonal-ab-immunohistochemistry-3152022161010.jpg)
![Western Blot UNC5H2/UNC5B Antibody [Unconjugated]](https://images.novusbio.com/images/af1006_rat-unc5h2-unc5b-affinity-purified-polyclonal-ab-822024950324.jpg)
![Western Blot Carboxylesterase 2/CES2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxylesterase_2_AF5657_Western_Blot_12283.jpg)
![Immunohistochemistry Carboxylesterase 2/CES2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5657_human-carboxylesterase-2-ces2-affinity-purified-pab-immunohistochemistry-342025114554..jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")