CLCNKA Antibody - Azide and BSA Free

Images

 
Western Blot: CLCNKA Antibody [NBP2-92433] - Analysis of extracts of various cell lines, using CLCNKA .Exposure time: 90s.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CLCNKA Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 470-644 of human CLCNKA (NP_001244068.1). QSCQPSFYDGTIIVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLVQALQAEPPSRAPGHQQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCNKA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for CLCNKA Antibody - Azide and BSA Free

  • chloride channel KaMGC61490
  • hClC-Ka
  • kidney, A

Background

The CLCNKA gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought tofunction in salt reabsor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLCNKA Antibody (NBP2-92433) (0)

There are no publications for CLCNKA Antibody (NBP2-92433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCNKA Antibody (NBP2-92433) (0)

There are no reviews for CLCNKA Antibody (NBP2-92433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCNKA Antibody (NBP2-92433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCNKA Products

Research Areas for CLCNKA Antibody (NBP2-92433)

Find related products by research area.

Blogs on CLCNKA

There are no specific blogs for CLCNKA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCNKA Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCNKA